SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000010889 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000010889
Domain Number 1 Region: 45-484
Classification Level Classification E-value
Superfamily Sema domain 2.75e-152
Family Sema domain 0.00000000328
Further Details:      
 
Domain Number 2 Region: 486-535
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000051
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000010889   Gene: ENSMGAG00000010484   Transcript: ENSMGAT00000011754
Sequence length 680
Comment pep:novel chromosome:UMD2:12:20453725:20457552:1 gene:ENSMGAG00000010484 transcript:ENSMGAT00000011754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGRSGPSAASSASFCVSQTVQRQPAAHGPRCCVVLIPRCPPADSAERVVQRFEVPGVSNY
TALLLSPDGGTLYLGAREVLFAVNTSHFQHSALARRLPWGADEEKKRQCVFKGKDPQRDC
HNYIKMLLQLNSTHLYTCGTCAFSPTCAYINMQHFTLERDGLGRVLLEDGKGRCPFDPEY
RSTAVMVDGELYAGTVSNFQGNEPTIYRSQESXPDGDDDKVYFFFSETGKEFDYFENTIV
SRIARVCKGDQGGERVLQRRWTTFLKAQLLCSHPEDGFPFNVLQDVFVLTPGEQRWRETL
FYGVFTSQWNKGGLGSSAVCAFPMHSVQKAFGGLYKEVNRETQQWYTDTSPVPEPRPGTC
ITSHTRHLKINSSLQMPDRVLNFVKDHFLMDSPVRSQPLLLQSRLRYQQIGVHRVQGLRG
TYDVLFLGTDDGRLHKAVRVNHRVHIIEEIRLFPTGQPILQLLLDHEQGLVYAASYTAVA
QVPFSNCSLYRSCGECVLARDPFCAWSHGACRSTTPHPPAHPQLWAQDIEGAETERLCQP
TNASQPRPRVLLPPASGTPCQRIQLPPNAVQPLPCRLLSNLASRRWLHNGTPVNASYLVL
PEGALILVGSPERAGTYECWSLEEGFRKLMASYCVAVQEPGRRGFTAPEAVSTSRSTSAV
GSIAARLDGKTYWTEFLVMC
Download sequence
Identical sequences G1NDG1
ENSMGAP00000010889 ENSMGAP00000010889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]