SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011218 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011218
Domain Number 1 Region: 26-137
Classification Level Classification E-value
Superfamily FKBP-like 5.5e-33
Family FKBP immunophilin/proline isomerase 0.00018
Further Details:      
 
Domain Number 2 Region: 110-204
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000628
Family Calbindin D9K 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011218   Gene: ENSMGAG00000010782   Transcript: ENSMGAT00000012088
Sequence length 210
Comment pep:novel chromosome:UMD2:6:34403882:34409519:-1 gene:ENSMGAG00000010782 transcript:ENSMGAT00000012088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EETHAWCLAXGVLLGCAAAALIPAADVKVEVLQKPFLCHRRTKGDMMLVHYEGFLQSDGS
MFHSTHKHNNGQPMWFTLGIREAIKGWDKGLKDMCVGEKRKLTIPPALAYGKEGKGKIPP
ESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKQEVKIYLKKEFEKHGAVVNDTQHD
ALVEDIFDKEDEDSDGFISAREFTYKHDEL
Download sequence
Identical sequences G1NE88
ENSMGAP00000011218 ENSMGAP00000011218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]