SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011255 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011255
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000025
Family HtrA-like serine proteases 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011255   Gene: ENSMGAG00000010819   Transcript: ENSMGAT00000012126
Sequence length 1230
Comment pep:known chromosome:UMD2:4:36867148:36894463:-1 gene:ENSMGAG00000010819 transcript:ENSMGAT00000012126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQVRNKSKAAKAGLCEGDEVVSINGKPCGDLTYAEVIVLMESLTDVLQMLIKRSSSEINE
TLSAERENGKHDNIKNEDYRESTTLQINTAKEIPHGNLCITEIYSETHQGAGESNIHFSE
MKQETTQSHRISPKVIGTSKALVTDESAFRGKIEERRPGNMVELQLSLSNDGHKSTNAPS
VTLLGAEKSTPSGRGPSVQEDGTNPVITIPLSVKEGNIQWSSKVVQFSSSKEVKMIQSAA
PSIPRVEVILDCSDREKEAPKSLAERGCVDSQVEGGQSEAPPSLPSFAISSEGTEQGEDN
QHSERDHRPLKHRARHARLRRSESLSEKQVKEAKSKCKSIALLLTAAPNPNSKGVLMFKK
RRQRARKYTLVSYGTGELERDEDEGEEGEVEEGDKENTFEVSLLATSESEIDEDFFSDID
NDKKIVTFDWDSGLLEVEKKTKSGDEMQTLPETTGKGALMFARRRQRMDQITAEQEEMKA
RTVHAEEQREVTVSENFQKVSSSAYQTKEEEMLRQQPCISKSYADVSQNDGKIVQQNGFG
VAPDTSLSFQSSEAQKAASLNRTAKPFPFGVQNRAAAPFSPTRNVTSPLSDLPAPPPYCS
ISPPPEALYRPLSAPAASKAAPILWSHTEPTERIASRDERIAVPAKRTGILQEAKRRSTS
KPMFSFKEAPKVSPNPALLSLVHNAEGKKGSGAGFESGPEEDYLSLGAEACNFMQSQASK
QKAPPPTAPKPSLKVSPAAGTPVSPVWSPAVASNKAPSFPAPASLQAAYPAPLKSPQYPH
SPSANPPNTLNLSGPFKGPQATLASPNHPAKTPTTPSAGETKPFEMPPEMRGKGAQLFAR
RHSRMEKYVVDSETVQANMARASSPTPSLPASWKYSSNVRAPPPVAYNPIHSPSYPPAAT
KPFPKSTAATKNTKRKPKKGLNALDIMKHQPYQLDASLFTFQPPSNKESLGIKQIPKLPT
SKQATSLRLPGSASPTNVRASSVYSVPAYSSQPSFQSNASTPVNESYTPTGYSAFSKPES
TTSSLFTAPRPKFSAKKAGVIAQERSSGRSLSLPGKPSFISRATSPTSPLIFQPAPDYFS
KPDTAADKPGKRLTPWEAAAKSPLGLVDEAFGPQNMQESIAANVVSAAHRKTLPEPPDEW
KQKVSYEPPGPSASLALLGGKQSGVTSARKSSLSVSNATTQAGSQQQYAYCSQRSQTDPD
IMSMDSRSDYGLSTADSNYNPQPRGWRRPT
Download sequence
Identical sequences G1NEB6
ENSMGAP00000011255 ENSMGAP00000011255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]