SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011317 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011317
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000000000796
Family Pancreatic carboxypeptidases 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011317   Gene: ENSMGAG00000010873   Transcript: ENSMGAT00000012190
Sequence length 109
Comment pep:novel chromosome:UMD2:10:23683050:23697458:-1 gene:ENSMGAG00000010873 transcript:ENSMGAT00000012190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KINLEFYIDIHAHSTMMNGFMYGNIFENEERFQRQAVFPKLLCQNAEDFSYSSTSFNRDA
VKAGTGRRFLGGLLNDTSYCYTLEVSFYSYIVGGTTAAVPYTEEACILL
Download sequence
Identical sequences G1NEG0
ENSMGAP00000011317 ENSMGAP00000011317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]