SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011324 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011324
Domain Number 1 Region: 323-432
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-31
Family SH2 domain 0.00000535
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.44e-28
Family Ras-binding domain, RBD 0.00038
Further Details:      
 
Domain Number 3 Region: 123-236
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-16
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011324   Gene: ENSMGAG00000010861   Transcript: ENSMGAT00000012197
Sequence length 435
Comment pep:novel chromosome:UMD2:7:21193733:21219290:1 gene:ENSMGAG00000010861 transcript:ENSMGAT00000012197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVIKVYSEDDSSKTLEIPSDITARDVCQLLILKNHYIDDHNWTLFEELTHTGLVERAIED
HELVMEVQSNWGMEEENKFYFRKNYVKYEFFKNPVSFFPDHMISFSSETNAAVKHSGILQ
MFLSSSTYPEIHGYLHAKEQGKKSWKKLYFVLRRSGLYFSTKGTSKEPRHLQFFCEFSNS
DIYMFLTGKKISGAPTSYGFCFKPNKSGGTRDLKQLCADDEQSRTCWMTAIRLFKYGVQL
YQNFTQPYQGRSGCSPLSMTPMRSISENSLVAMDFSGHRSRIIENPTEALSVAVEEGLAW
RRRGCLRLNSHCSPIAISNMDIFISTAIHRTQSWFHHKISRDEAQRLILQHGLVDGVFLV
RDSQSNPRTFVLSLSHGLKIKHFQIVPLEDDGKLFYTLDDGHTRFTDLIQLVEFYQLNKG
VLPCKLKHYCARIPL
Download sequence
Identical sequences G1NEG6
ENSMGAP00000011324 ENSMGAP00000011324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]