SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011348 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011348
Domain Number 1 Region: 262-440
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000021
Further Details:      
 
Domain Number 2 Region: 2-162
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.33e-35
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 136-237
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011348   Gene: ENSMGAG00000010876   Transcript: ENSMGAT00000012222
Sequence length 670
Comment pep:novel chromosome:UMD2:10:13436164:13457599:1 gene:ENSMGAG00000010876 transcript:ENSMGAT00000012222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QERKKKFEKDGEKFYSMLDRHLHLSSKKKESQLQEADLQVDKERHNFFESSLEYVYQIQE
VQESKKFSIVEPVLAFLHSLFTYNNLTVELTQDFLPYKQQLQLSLQNTRNHFSSTREELE
DLKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKEAKTLRMTPIDQKP
GAKQGTLDLTLKSCVRRKTDSIDKRFCFDIETNERSGTITLQALSEANRRLWMEAMDGKE
PIYHSPITKQEEMELNEVGFKFVRKCINAVETKGISTEGVYRTVGSNIQVQKLLNAFFDP
KCPGDVDLQSSDWDIKTITSSLKFYLRNLSEPVMTYKLHKELVLAAKSENLDYRLGAIHA
LVYKLPDKNREMLELLIRHLVNVCEHSRENLMSPSNMGVIFGPTLMRAQEDTVAAMMNIK
FQNIVVEILIEHFGKIYSGPPEDSAAPPVPPPRVAARRHKPITISKRPLRERPVFFGASV
EESGAQTLTGRMALPAQPDPQRQHHHGGPQTSAAQPPARAAAGGEEAGRPPAELEVGKVT
ARLQDGAVKLPGKAANGVVSSPALRTSTLHARRPAPRPGGCGRDGEYDGVPKPRPHGDKP
VITRPPVRPPDPPCRAPIPQKLEQRPDLIAGTAEEMPSSVVASRTKFFETASRRTSSSSS
PQGRIPGDES
Download sequence
Identical sequences G1NEI7
ENSMGAP00000011348 ENSMGAP00000011348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]