SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011571 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011571
Domain Number 1 Region: 11-83
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-18
Family PDZ domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011571   Gene: ENSMGAG00000011086   Transcript: ENSMGAT00000012449
Sequence length 368
Comment pep:known chromosome:UMD2:4:40330792:40415855:1 gene:ENSMGAG00000011086 transcript:ENSMGAT00000012449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNYSVSLVGPAPWGFRLQGGKDFNMPLSISRLNDGGKAARAHVGIGDVVLTIDGISTDG
MTHLEAQNKIKACTGNLNMTLQRVASATKPDLIHVPKGEPKEVVKPVPVASAAASKVTAM
ASVAYNKTPRPFGAVTSSKVTSIPSPSSAFTPAQAAPMLPTPAPFAAPGLHVNAKPNADG
RPPTPSTAKPAVNVPRQPATHNAAPGGHVGDSTQELAEGLRRGFRENQGDNKQQNGPPRK
HIVDTYTEFYHTPTHSDASKKRLIEDTEDWHPRTGTTQSRSFRILAQITGTDHMKEPEHE
GSKKSNDSMEPTPPATHTATSVRNVSASHESPDPRPTPTNNATSPSVPKLTGPPSGAKYS
GWQPPSQA
Download sequence
Identical sequences G1NF17
ENSMGAP00000011571 ENSMGAP00000011571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]