SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011573 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011573
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.92e-83
Family Integrin A (or I) domain 0.0000000657
Further Details:      
 
Domain Number 2 Region: 353-458
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-23
Family Integrin domains 0.00057
Further Details:      
 
Domain Number 3 Region: 622-704
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.18e-18
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 20-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000785
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 579-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000142
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000123
Family Integrin beta EGF-like domains 0.0094
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.0000023
Family Integrin domains 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000011573
Domain Number - Region: 506-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011573   Gene: ENSMGAG00000011082   Transcript: ENSMGAT00000012451
Sequence length 788
Comment pep:novel chromosome:UMD2:7:22919048:22946923:1 gene:ENSMGAG00000011082 transcript:ENSMGAT00000012451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLQRNNDVQGTCSLESGVTCEDCLLSGPHCAWCFQENYTDSVGIHGRCD
TPENLLSKGCQLNFIEFPISEVEIHRNKPLTIATQKDNSDVTQISPQKLTLRLRPGHEET
IQIKVRQSEDYPIDLYYLMDLSASMDDDLNTIKELGSTLSKEMSKLTSNFRLGFGSFVEK
PVSPFIKTTAEEISNPCRSVPYECLPTFGYKHVLSLTNDAERFNEIVKGQRISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGNCHLDHNNE
YSMSTILEYPTIGQLIDKLVQNNVLVIFAVTNEQVHTYENYAKLIPGATVGRLQKDSGNI
LQLIIAAYQELRSEVELEVFGDTEGLNLSFTAICNNGTFFPHQRKCSHVKVGDTVSFNVT
INLPTCDKTTRHVVIKPVGLSDMLEMEILPQCSCSCQAKAERNSSKCNKGKGTFECGVCV
CHPGYMGPHCECDENALSTGSCKGSVEQSSCSGRGSCYCGQCVCHPSMYGRVYGAHCECD
DFSCVRHRGLQCGGNGDCDCGECVCHSGWTGEYCNCTTDTSSCISEDGMLCSGRGECICG
SCVCIHPGASGQTCEKCPLCGDPCSSRRSCVECHLASDDKLQGECSEKCKSVDATVSTAE
DFSEDKSIPCSLQGENECITTFLLTVDEQGKTVIHSIKQKDCPELPNIPMIMVGVTLAIL
LIGIVLLCIWKLMVSVQDRKEVAKFEAEKSKVKWQTETNPLYRGSTSTFKNVTYKNQEKQ
KEAMAADF
Download sequence
Identical sequences G1NF19
ENSMGAP00000011573 ENSMGAP00000011573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]