SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011624 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011624
Domain Number 1 Region: 36-208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.99e-51
Family G proteins 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011624   Gene: ENSMGAG00000011131   Transcript: ENSMGAT00000012503
Sequence length 242
Comment pep:novel chromosome:UMD2:5:24981173:24985821:-1 gene:ENSMGAG00000011131 transcript:ENSMGAT00000012503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKPQDLAAATPADERTPLPNHEKPWRNQTSPPATGRVKCVLVGDGAVGKTSLVVSYTTNG
YPDEYQPTALDTFSATVQVLVDGAPVRIQLWDTAGQEDFDCLRSLCYPDTDVFLVCFSVV
NPSSFQNITEKWIPEIRTHNPRAPVLLVGTQADLRDDVNVLISLDRYHVKPVPRPQAEGL
ADKIRAEAYLECSALTQKNLKEVFDMAIVSGVEHKARQEKKMTAKGIKTLSKCRWKKFFC
FV
Download sequence
Identical sequences G1NF58
ENSMGAP00000011624 ENSMGAP00000011624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]