SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011756 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011756
Domain Number 1 Region: 321-585
Classification Level Classification E-value
Superfamily NHL repeat 5.75e-50
Family NHL repeat 0.000055
Further Details:      
 
Domain Number 2 Region: 203-297
Classification Level Classification E-value
Superfamily E set domains 4.87e-25
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 2-48
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000029
Family B-box zinc-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011756   Gene: ENSMGAG00000011254   Transcript: ENSMGAT00000012637
Sequence length 585
Comment pep:novel chromosome:UMD2:6:41380451:41391399:-1 gene:ENSMGAG00000011254 transcript:ENSMGAT00000012637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLHFYCDTCSVPICRECTMGRHVGHSFIYLQDALQDSRTLTIQLLADAQQGRQAIQLSI
EQAQAVAEQVEMKAKVVQSEVKAVTTRHKKALEERECELLWKVEKIRQVKAKSLYLQVEK
LRQNLNKLDNTISAVQQVLEEGRTIDILLARDRMLAQVQELKNVRGLLQPQEDDRIMFTP
PDQALYMAIKSMGFVSSGAFAPLTKATGEGLKRALQGKVASFTVIGYDHDGEPRLSGGDM
ISAVVMGPDGNLFRADVSDQQNGTYLVSYRPQLEGEHLVSVMMCNQHIENSPFKVVVKSG
RSYIGIGLPGLSFGSEGDSDGKLCRPWGVSVDKEGYIIVADRSNNRIQVFKPCGTFHHKF
GTLGSPAGQFDRPAGVACDVSRRIVVADKDNHRIQIFTFEGQFILKFGEKGTKNGQFNYP
WDVAVNAEGKILVSDTRNHRVQLFGPDGVFLNKYGFEGALWKHFDSPRGVTFNHEGHLVV
TDFNNHRLLVIHADCQSARFLGSEGSGNGQFLRPQGVAVDQEGRIIVADSRNHRVQIFES
NGSFLCKFGTQGSGFGQMDRPSGIAVTPDGMIVVVDFGNNRILVF
Download sequence
Identical sequences G1NFH0
ENSMGAP00000011756 ENSMGAP00000011756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]