SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000011812 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000011812
Domain Number 1 Region: 108-351
Classification Level Classification E-value
Superfamily vWA-like 3.21e-74
Family Integrin A (or I) domain 0.000000706
Further Details:      
 
Domain Number 2 Region: 351-435
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-16
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 3 Region: 9-67
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000068
Family Plexin repeat 0.00099
Further Details:      
 
Domain Number 4 Region: 556-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Integrin beta EGF-like domains 0.0039
Further Details:      
 
Domain Number 5 Region: 512-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000246
Family Integrin beta EGF-like domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000011812
Domain Number - Region: 476-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0809
Family Integrin beta EGF-like domains 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000011812   Gene: ENSMGAG00000011297   Transcript: ENSMGAT00000012693
Sequence length 732
Comment pep:novel chromosome:UMD2:3:1702087:1730741:-1 gene:ENSMGAG00000011297 transcript:ENSMGAT00000012693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVLYFIAAENRCATSNAVTCTKCLALGPECGWCAQEDFMADSTQKGRCDTVFNLLKRGCQ
SDFVESPTVHVTIPSDQETNTQVTPGRVSVQLRPGSEASFILRVHPLEKYPVDLYYLVDV
SASMHNNIEKLNSVGFALSKKMENISLDFRLGFGSYVDKTVSPYISIHPGRIHNQCSDYN
LDCMPPHGYIHVLSLTDNIAEFRNAVNKQKISGNIDTPEGGFDAMLQAAVCQSHIGWRKE
AKRLLLVMTDQTSHLALDSKLAGIVIPHDGNCHLKDNVYVKATSMEHPSLGQLSEKLIDN
NINVIFAVQGSQFHWYKDLLPLLPGTVARQIESQAANLNDLVVEAYQKLISEVKIQVDNQ
IQDLNFNITAMCPDGSKKTGMEGCKNVGYNEEVLFNVSVTMKGCDTTGGRKYAILKPIGF
NETTIINVQKSCACQNGDNAKPKRVWVDETFPDGKQPHCSDSSCSYSRETFPSEECRKHK
DQPICSGQGDCIEGKCFCYKNKLGRVYGKYCEMDDFSCPYHQGNLCSGNGECEAGKCKCF
ADWEGDRCQCSLQSAKQCLNSKGQICSGRGNCVCGKCECTDPRSFGRLCEYCPACNKACE
ENWNCVQCHHSNNASQAKLDQCKTSCAYLLHYVDQTSECFSGRSYFRVFSIIFIVTFLIG
LLVVLIIRQIILQGNSNKVKSSADYRVSATKKEKMFLPTVCTRTVTYRRDKPEEINIDIS
KLRLNETFKCEF
Download sequence
Identical sequences G1NFL5
ENSMGAP00000011812 ENSMGAP00000011812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]