SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012094 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012094
Domain Number 1 Region: 26-151
Classification Level Classification E-value
Superfamily E set domains 0.000000014
Family ML domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012094   Gene: ENSMGAG00000011558   Transcript: ENSMGAT00000012981
Sequence length 155
Comment pep:novel chromosome:UMD2:3:68372367:68378639:1 gene:ENSMGAG00000011558 transcript:ENSMGAT00000012981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEFVFFILFTPGVSGFFCTSSDLELSYTFCDSSSHYFKFNVTPCSMLNKSVWYAAVTWI
PKSDVTFLKIVFTVWYEGARALQWGEVLCSGTDDEYSLCGRLKGETIDTEFDIKGKRTLF
PKGHYIVVLQAFSDDSEKNIITCLNFTMIVKQDSF
Download sequence
Identical sequences G1NG98
XP_010707351.1.16129 ENSMGAP00000012094 ENSMGAP00000012094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]