SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012095 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012095
Domain Number 1 Region: 14-207
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.83e-57
Family Prokaryotic proteases 0.000000662
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-23
Family HtrA-like serine proteases 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012095   Gene: ENSMGAG00000011551   Transcript: ENSMGAT00000012982
Sequence length 322
Comment pep:novel chromosome:UMD2:8:34190046:34217119:1 gene:ENSMGAG00000011551 transcript:ENSMGAT00000012982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEHPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPYSKREIPVASGSGFIVSEDGLIVTN
AHVVTNKNRVKVELKNGETYEAKIKDVDEKADIALIKIDAQGKLPVLLLGQSGDLRPGEF
VVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGE
VIGINTLKVTAGISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTPSKAREL
KDRHKDFPDVVSGAYVIDVIPETPAEAGGLKDNDVIISINGQSITSASDVSDIIKKDSTL
NMVVRRGNEDVMLTVIPEEIDP
Download sequence
Identical sequences G1NG99
ENSMGAP00000012095 ENSMGAP00000012095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]