SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012330 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012330
Domain Number 1 Region: 487-834
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 3.66e-113
Family Rap/Ran-GAP 0.000000517
Further Details:      
 
Domain Number 2 Region: 962-1037
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000116
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012330   Gene: ENSMGAG00000011759   Transcript: ENSMGAT00000013220
Sequence length 1795
Comment pep:novel chromosome:UMD2:5:27808581:27871954:-1 gene:ENSMGAG00000011759 transcript:ENSMGAT00000013220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLKRSQTERAVATGVKGCCHWVSVGTDGTTKVHSDDFYMRRFRSQNGSLGSAVMAPVG
PPRNESSHHVTSTPGVPKMGVRARIADWPPRKENIKETSRSSQDIETASCLDSMSSKSSP
GSQGSSVNLNASDSVMLKSIQNTLKSKTRQSENLDSRFLTPDGYPSSPRKALRRIRQRSN
SDITISELDVDSFDECISPTFKSGPSLHREYGSTSSIDKQGTSGESFFDLLKGYKDEKSD
QRSPGTTKLSELLIASGSKGSGFSLDVIDGPITQRENLRLFKEREKPLKRRSKSETGDSS
IFRKLRNAKGEGELGKSSDLEDNRSEDSVKPWTCPKCFAHYDVQSILFDLNEAAINRHNV
IKRRNTTTGASAAAVASLVSGPLSHSASFNSPMGSTEDLNSKGSLNMDQGDDKSNELVMS
CPYFRNEIGGEGERKISLSKSNSGSFSGCESASFESTLSSHCTNAGVAVLEVPKENLILH
LDRVKRYIVEHVDLGAYYYRKFFYQKEHWNYFGADENLGPVAVSIRREKPEEIKENGPQY
NYRIIFRTSELMTLRGSVLEDAIPSTAKHCTARGLPLKEVLEYVVPELNIHCLRLAFNTP
KVTEQLMKLDEQGLSYQLKVGIMYCKAGQSTEEEMYNNESAGPAFEEFLQLLGERVRLKG
FEKYRAQLDTKTDSTGTHSLYTTYKDYEIMFHVSTMLPYTPNNKQQFFSLLRKRHIGNDI
VTIVFQEPGAQPFSPKNIRSHFQHVFVIVRVHGPCTDSVCYSVAVTRSRDVPSFGPPIPK
GVTFPKSNVFRDFLLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAEKNVTNTPIDPSG
KFPFISLASKKKEKSKPYPGAEIYSSGAIVWSVHAKDYSKGMEIDCLLGVSNEFVILIEQ
DTKSVVFNCSCRDVIGWTSTDTNIKIFYERGECVSLESFISNIDDIKEIVKRLELMTKGC
ETVEMTLRRNGLGQLGFHVNYEGIVADVEPYGYAWQAGLRQGSRLVEICKVAVATLSHEQ
MIDLLRTSVTVKVVIVPPYEDCTPRRYCCSTTFPVSCINFFRQERSFICPLVVNGKLNTS
GIKMHSGIRSPMSKSSIISPANRRISGGRVTYLIIPDGRQPRINIRLRHEGKQQQTTLSP
GSDVYVTVSSIALARSQQCRNSPSNLSTSSETGSAGSTYRQKSMPEGFGISRRSPASIDR
QSTQSDTGGSGKSTPSWQRSEDSIADQMEPTCHLPAVSKVLPSFRESPSGRLMRQDPVVH
LSPNKQGHSDSHYSSHSSSNTLSSNASSAHSDEKWYDSGERTESELNSYNYLQGTSADSG
IDTTSYGPSHGSTASLGAATSPRTGLTKEKVTPLWHSSSEVVSIVDRTLEKESHIDRKAE
SSLSLDIHSKSQPASNPLTRENSAYSISDAVSHTSTMSSRHSASPVVFTSARSSPKEELH
SATSPQLAPSFSSSSSSSSGPRTFYPRQGATSKYLIGWKKPEGTINSVGFMDTRKRHQSD
GNEMAHPRLRASARDLRASPKRASKSTVEEDLKKLIDLDSPTPESQKNFKLHVLSEPQSP
FPSTPTTRRALQRTLSDESIYSGQRDHFFASRASLLDQAMPNDVLFTSTYPSLPKSLPLR
RPSYTLGMKSLHGEFSASDSSLTDIQEQRRQPMPDPGLMPLPDSASDLDWSNLVDAAKAF
EVQRASFFAVADENHRPVSAASSGDQAEDQLTAQIKPYTGKESPPTLASKVDQLEGLLKM
LQEDLRPKEKEDKANLQAEVQHLREDNLRLQEESQNATEKLKKFTEWVFNTIDMN
Download sequence
Identical sequences G1NGT7
ENSMGAP00000012330 ENSMGAP00000012330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]