SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012510 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012510
Domain Number 1 Region: 246-307
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-22
Family SH3-domain 0.00055
Further Details:      
 
Domain Number 2 Region: 67-121
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.69e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012510   Gene: ENSMGAG00000011923   Transcript: ENSMGAT00000013406
Sequence length 333
Comment pep:novel chromosome:UMD2:6:46746205:46786346:1 gene:ENSMGAG00000011923 transcript:ENSMGAT00000013406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLQKLKRSLSFKTKSLRSKSADNFFQRTNSDVKLQVDLMPEVSTSTGQLPSSESQASSPT
RTQQLSENNKTHIFQEHIFKKPTFCDVCNHMIVGTNAKHGLRCKACKMSIHHKCADSIGQ
QRCMGKLPKGFRRYYSSPLLIHEQFGCIKEVMPIACGNKVDPVYETLRFGTSLAQKTKKG
SSGSGSDSPNRNSTADLAEVPEEADSSLDLSRKRSNSVFTYSENGTEHFGEEPKSIHSPG
PFYKSTLQMNTYVALYKFVPQENEDLEMRPGDMITLLEDSNEDWWKGKIDDRTGFFPANF
VQRVQHDEKIYRCIRTFIGCKEQGQITLKENQV
Download sequence
Identical sequences G1NH77
ENSMGAP00000012510 ENSMGAP00000012510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]