SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012571 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012571
Domain Number 1 Region: 59-224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000297
Family BAR domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012571   Gene: ENSMGAG00000011983   Transcript: ENSMGAT00000013467
Sequence length 281
Comment pep:novel chromosome:UMD2:3:76464992:76480687:1 gene:ENSMGAG00000011983 transcript:ENSMGAT00000013467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSLVSRDNQTRQIQDAVSNVEKHFGELCQIFAGYVRKTARLRDKADLLVNEIYAYAATE
TPNLKVGLKNFADEFSRLQDYRQAEVDRLEAKVVEPLKSYGTIVKLKRDDLKATLTAKNR
EAKQLSQLEKTRQRNPSDRHIISQAESELQRASLDATRTTRQLEETIDNFEKQKIKDIKN
IFSEFITIEMLFHGKALEIYTAAYQNIQNIDENEDLEVFRSSLYPPDYQSRLDIVRAISK
SPLQRTGSLKSSLKTVQISSSTTRKNEEEEEEEEDEEEEEE
Download sequence
Identical sequences G1NHC4
ENSMGAP00000012571 ENSMGAP00000012571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]