SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012627 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012627
Domain Number 1 Region: 3-402
Classification Level Classification E-value
Superfamily Sema domain 1.7e-130
Family Sema domain 0.000000109
Further Details:      
 
Domain Number 2 Region: 695-747
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.37e-16
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 3 Region: 507-557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000445
Family TSP-1 type 1 repeat 0.00035
Further Details:      
 
Domain Number 4 Region: 749-807
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000615
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 398-448
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000523
Family Plexin repeat 0.004
Further Details:      
 
Domain Number 6 Region: 561-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000102
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 7 Region: 807-853
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 452-504
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000366
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012627   Gene: ENSMGAG00000012023   Transcript: ENSMGAT00000013523
Sequence length 993
Comment pep:novel chromosome:UMD2:7:27924378:27997445:-1 gene:ENSMGAG00000012023 transcript:ENSMGAT00000013523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QATAWGSDEDTRRSCQSKGKTEEECQNYVRVLIVYGKKVFTCGTNAFSPVCSSRQVGNLS
KIIDRINGVARCPYDPRHNSTAVITSRGELYAATVIDFSGRDPAIYRSLGNVPPLRTAQY
NSKWLNEPNFIAAYDIGLFTYFFFRENAVEHDCGKTVYSRVARVCKNDIGGRFLLEDTWT
TFMKARLNCSRAGEIPFYYNELQSTFYLPEQDLIYGVFTTNVNSIAASAVCAFNLSAITQ
AFNGPFRYQENPRSAWLPTANPIPNFQCGTLSDDSPNENLTERVLQDAQRLFLMNDVVQP
VTVDPYVTQDSIRFSKLVVDIVQGKDTLYHVMYIGTEYGTILKALSTTNRSLRSCYLEEM
QILPDGQREAIKSLQILHSDRSLFVGLNNGVLKIPLERCSMYRTEGECLGARDPYCGWDN
KQKRCTTIEDSSNMSLWTQNITECPVKNLTTNGRLGPWSPWQLCEHSDGDSTGSCMCRSR
SCDSPRPRCGGRSCEGARIEVANCSRNGAWTPWSSWAPCSTSCGIGFQVRQRSCSNPAPR
YGGRVCVGQSREERFCNENSPCPLPIFWSSWGPWNKCSVNCGGGIHSRQRSCENGNTCPG
CSVEYKTCNPESCPEVRRNTPWTPWMPVNITQNGARQEQRFRYTCRAQLSDPHELQFGRK
KTESRFCPNDGSAMCETDSLVDDLLKTGKTPARIINGGWSFWGAWSSCSRDCELGFRIRK
RTCTNPEPKNGGLPCVGSAMEYQDCNPHPCPVKGSWSCWTPWSQCSATCGGGHYQRTRTC
TNPAPSSGEDICIGLHTEEALCNTHPCEGGWSEWSEWSLCNEEGIQYRSRYCEVHSPDSS
QCIGNSTQYQDCLYNEIPVILPASSIDESTNCGGFSLIHLIATGVSCFFGSSLLTFVIYV
YCQRCQRQSQESTVIHPTTPNHLHYKGNTTPKNEKYTPMEFKTLNKNNLIPDDRTNFYPL
QQTNVYTTTYYPSTLNKYDYRPEASPGRTFTNS
Download sequence
Identical sequences G1NHH1
ENSMGAP00000012627 ENSMGAP00000012627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]