SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012654 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012654
Domain Number 1 Region: 5-231
Classification Level Classification E-value
Superfamily L domain-like 3.74e-48
Family Internalin LRR domain 0.045
Further Details:      
 
Domain Number 2 Region: 1267-1356
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-22
Family PDZ domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012654   Gene: ENSMGAG00000012039   Transcript: ENSMGAT00000013550
Sequence length 1360
Comment pep:novel chromosome:UMD2:10:30138672:30183646:1 gene:ENSMGAG00000012039 transcript:ENSMGAT00000013550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSMHKLTQLERLDLGNNEFSELPEVLEQIQNLKELWMDNNSLQILPGSIGKLKQLVYLDM
SKNRIETVDLDISGCEGLEDLLLSSNMLQQLPDSIGLLKRLTTLKVDDNQLTILPNAIGN
LSLLEEFDCSCNELESLPSTIGYLHNLRTLAVDENFLPELPREIGSCKNVTVMSLRSNKL
EFLPDEIGQMQKLRVLNLSDNRLKNLPFTFTKLKELAALWLSDNQSKALIPLQTEAHPET
KQRVLTNYMFPQQPRSDEDFQSDSDSFNPTLWEEQRQQRMTVAFEFEEKKEEEENPGKVK
SLTYKMNTERWGLGITLQPRVKSNDCMQAPFAHLMNSIQSYCVPSPSSALGWGGVSGLSL
FSCISVYLGAEFTYLSVSMNVQVEINLKRYPTPYPEDLKNMVKSVQNLVGKTSHGVRPEN
SAPTANTEQTVKEKYEHKWPMAPKEISVEDAFGHPASEMRIGELRPSLPETPLYPPKLVL
LGKDKKESTDESEADKIHCLNNSVSSGTYSDYSPSQASSGSSNAHVKMGSLQTTAKEAVN
NSLWGNSRLVQSFPQPLETKPLLSQRESAPAGNVPPRTDRRPLSETFTDSWNDSSHYDNT
GFVAEESAVENPSANPLLSTKSRSTSAHGRRPLIRQDRIVGIPLELEQPTLRNTHESEVP
PPNPWQNWTRTPSPFEDRTAFPSKLESTPTTSPLPERKDHVKESPEITSTFAPGIAWEYH
DSNANRSLTNVFSHIHCRPDPSKSVISISKSTERLSPMMRDLKTNKFKKSQSIDEIDIGT
YKVYNIPLENYASGNDTVGAHERVDKLLGPEHGMLSMSRSQSVPMLDDELLTYGSVKVQP
QQKSSVTKKVYQFDQSFNPQGAVEVTAEKRLPPPFQLNPEYIAPQSKNLPQELVSPRAYR
GYPPVEHMFSFSQPSVNEDAVSTPFTSQGSRPGFLRRADSLASSTEMSMFRRVSEPHELP
PGDRYGAPYRGAVERQGSISVSESQFLKRNGRYEDEHPSYQEVKAQTGSFPVKNLTQRRP
LSARSYSTESYGTSQTRPVSARPTMAALLEKIPSDYNLGNYGDKPSDNSDIKTRPTPVKG
NESCAKMPADWRQQLLRHIEARRLDRTAAYKHNTVSLGMLHSGGFSAMHAGRSMTLNLQT
KSKFENQMLQELPLPKTPSQQSSVLDNGQDEGPGSGQWNPYPLGRRDVPPDTVSKKAGSH
IQTLMGSQSLQHRSREQQYEGNMNKVTIQQYQPPLPIQIPSLAEPSRAPQTGDASSRQGQ
RSTDAYQEQFCVRIEKNPGLGFSISGGISGQGNPFKPSDKGIFVTRVQPDGPASSLLQPG
DKILQANGHSFVHMEHEKAVLLLKSFQNTVDLVIQRELTV
Download sequence
Identical sequences G1NHJ4
ENSMGAP00000012654 ENSMGAP00000012654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]