SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012714 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012714
Domain Number 1 Region: 1123-1302
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-52
Family DBL homology domain (DH-domain) 0.0000000144
Further Details:      
 
Domain Number 2 Region: 1762-1958
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-50
Family DBL homology domain (DH-domain) 0.0000144
Further Details:      
 
Domain Number 3 Region: 1309-1429
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-34
Family Pleckstrin-homology domain (PH domain) 0.00000204
Further Details:      
 
Domain Number 4 Region: 1956-2074
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-33
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 5 Region: 128-264
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 6 Region: 941-1078
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-18
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 7 Region: 694-844
Classification Level Classification E-value
Superfamily Spectrin repeat 9.32e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 350-491
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 9 Region: 2161-2225
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000429
Family SH3-domain 0.0000489
Further Details:      
 
Domain Number 10 Region: 1488-1553
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000208
Family SH3-domain 0.0034
Further Details:      
 
Domain Number 11 Region: 41-159
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000432
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 12 Region: 496-557,585-618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000393
Family Spectrin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012714   Gene: ENSMGAG00000012096   Transcript: ENSMGAT00000013611
Sequence length 2237
Comment pep:novel chromosome:UMD2:7:29033860:29289881:1 gene:ENSMGAG00000012096 transcript:ENSMGAT00000013611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSMVSVEGLAKLVDPSQLTDEFEGSLDYNHDEWIELRVSLEEFFNSAIHLLSRLEDLQEM
LARKEFPVDVEGSRRLIDEHTQLKKKVIKAPVEELDREGQRLLQCIRCSDGFSGRNCIPG
SADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNK
ELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHYASQQIK
QISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQLLSGVEVLCSLCQTSQAPCSIFSV
ELCLREEAHISMKETCFFTQVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDV
VHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSL
HRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFV
RRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKELLEDVCADSVDAVQELIKQFQQQQTAT
LDATLNVIKEGEDLIQQLRLMPLDLTQEVQSRDRDSAVSNNKTPHNSSISHIESVLQQLD
EAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQMNDFNTEDLTLAE
QRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKDIDLATQVQELLEFL
HEKQHELELNADQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLVNASSLSEAEQ
LQREHEQFQLAIEKTHQSALQVQQKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMED
RLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLE
QKEAFLKACTLARRNAEVFLKYIHRNNVSMPGVASHTRGPEQQVKAILSELLQRENRVLH
FWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHNSTGESAEETQELLKEYGEF
RVPAKQTKEKVKLLIQLADSFVEKGHIHAAEIRKWVTTVDKRYRDFSLRMGKYRYSLEKA
LGINTEDNKDLELDIIPASLSDREVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYV
RDLHECLETYLWEMTSGVEEIPAGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPED
VGHCFVTWADKFQMYVTYCKNKPDSSQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQR
ITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELIL
QDSFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHV
EGDPCKFALWSGRTPSSDNKTVLKASSIETKQEWIKNIREVIQERIIHLKGALKEPIQLP
KTPAKQRNNSRRDGVDDADSQGDGSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDF
TAGHSSELSIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSSALCISHSRSSVEM
DCFFPSGKEAYSVSSNENGGKSDSVANLQPQPSLNSQSSPGPKRSTNTLKKWLTSPVRRL
NSGKAESNIKKQKKVRDGRKSFDLGSPKTGDETTPQGDSADEKSKKGWGEDEPDEESHTP
LPPPMKIFDNDPTQDEMSSSLLAARQSSSDVPTAADLVSAIEQLVKSKLTLEGGSYRGSL
KDATGCLNEGMAPSTPPRNLEEEQKAKAMRGRMFVLNELVQTEKDYVKDLGTVVEGFMKR
IEEKGVSEDMKGKDKIVFGNIHQIYDWHKDFFLAELEKCLQEHDRLAQLFIKHERRLHMY
VVYCQNKPRSEYIVAEYEAYFEEVQQEINQRLTISDFLIKPIQRITKYQLLLKDFLRYSE
KAGLECSEIEKAVELMCLVPKRCNDMMNLGRLQGFEGKLTAQGKLLQQDTFYVTEQDSGV
QSRPKERRVFLFEQIVIFSELLRKGSLTPGYMFKKSIKMNYLVIEENVDNDPCRFALMSR
ETSERVILQAANPEIQQAWVQDINQVLDTQRDFLNALQSPIEYQRKESSTAVLRPQAGRV
AQPNSRPYSSVPVGSEKPLKATSRNPSLPPLKISTSNGSTGYEQPGDKYEQSKQTDLGGC
NGTSSMVVIKDYYALKEDEICVNQGEVVQILAINQQNMFLVYQPANDHSPAAEGWIPGNI
LAPLTKSTADNSDGSIK
Download sequence
Identical sequences G1NHP1
ENSMGAP00000012714 ENSMGAP00000012714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]