SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012742 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012742
Domain Number 1 Region: 137-386
Classification Level Classification E-value
Superfamily vWA-like 7.23e-79
Family Integrin A (or I) domain 0.0000000252
Further Details:      
 
Domain Number 2 Region: 383-471
Classification Level Classification E-value
Superfamily Integrin domains 6.28e-28
Family Integrin domains 0.0000954
Further Details:      
 
Domain Number 3 Region: 639-721
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000458
Family Integrin beta tail domain 0.00037
Further Details:      
 
Domain Number 4 Region: 30-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000288
Family Plexin repeat 0.00077
Further Details:      
 
Domain Number 5 Region: 596-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family Integrin beta EGF-like domains 0.0019
Further Details:      
 
Domain Number 6 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000248
Family Integrin beta EGF-like domains 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012742   Gene: ENSMGAG00000012123   Transcript: ENSMGAT00000013640
Sequence length 804
Comment pep:novel chromosome:UMD2:7:29324103:29362492:-1 gene:ENSMGAG00000012123 transcript:ENSMGAT00000013640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APKTISVLFKYFLGKLSPPHSLSFLVEGLNLCTSGSASSCEECLLIHPKCAWCSKEEFGS
TKSVPSRCDFLQNLIANGCAGAIENPRSSSSVVKNIPLSSKGSGQSHLDVTQITPQKVAL
SLRPGDRTSFRVQVRQVEDYPVDLYYLMDLSLSMNDDLDNIRNLGTKLAEEMRKLTSNFR
LGFGSFVDKNISPFSYTAPRYQNNPCIGYKLFPSCVPSFGFRHLLSLTDKVDRFNEEVQK
QKVSRNRDAPEGGFDAILQAAVCKEKIGWRKEASHLLVFTTDDVPHIALDGKLGGGLVQP
HDGQCHLNEANEYSASSQLDYPSLALLGEKLAENNIHLIFAVTKSHYVLYKNFTALIPGT
TVEILHKDSKNIIELIVKAYNSIRSKVELTVWDSPEDIGLTFTATCQDGLSYPGLRKCGD
LKIGDTVSFEVAVEARGCPAEDTSHVFTIKPAGFRDTLEVAVTYNCLCGCTGHAEPASSK
CSSNGTYACGLCECDAGYLGARCECEEGAGGETQPGLCREVEGKPVCSGRGECSCNQCVC
YESEFGNIYGPFCECDDFSCARYKGVLCSGHGECHCGECKCHTGYIGDNCNCSTETAGCV
SSDGQMCSGRGNCICGRCQCTEPGAFGETCEKCPTCPGVCSTKRRDCIECKLFNSGRLDN
QTCQKHCKDELITTVDVLKTDDPNAILCAYPVNNCVMKFTYSELANGKSNLTVLKEPECS
SAPSAVTIVLAVIGSVVLIGTILLGLWKLLVTIHDRREFDRFQSERTRARYEMASNPLYR
KPISTHNVEFTFNKLNKSYNGTVD
Download sequence
Identical sequences G1NHR8
ENSMGAP00000012742 ENSMGAP00000012742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]