SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000012904 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000012904
Domain Number 1 Region: 119-225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.26e-28
Family Second domain of FERM 0.0013
Further Details:      
 
Domain Number 2 Region: 228-372
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-26
Family Third domain of FERM 0.0058
Further Details:      
 
Domain Number 3 Region: 15-119
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-18
Family First domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000012904   Gene: ENSMGAG00000012266   Transcript: ENSMGAT00000013803
Sequence length 621
Comment pep:novel chromosome:UMD2:2:43025954:43051558:1 gene:ENSMGAG00000012266 transcript:ENSMGAT00000013803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRALLSGRMHPEGRSVCVFLPDREQLSLTVGVKATGQELFQQVCDLVKIKEPHFFGLSI
VKNNEYVFIDLEQKLSKYFSKEWKKETSKVRQYDVAWSRGTEKFIPPFVAFFRVQYYVEN
GRVISDKVARQLYYCHLKEQVLMSRCNHKEEIYFLLAAYSLQADLGNYREEVHTGKYFEP
QAYFPQWIIAKRGSDYILKHAPEMHREQQGLSAKEAVLKFIKESCLLEDVPVHFYRLQKD
KKEDRPTVILGLTLRGMHIYQEVNHVRQLLYDFPWSHIGKLAFLGKKFEIQPDGLPSARK
LVYYTGCPFRSRHLLQLLSNSHRLFLNIQPVLKQIQKLEEAEALEKKRYRESYISDTLDM
DLDPCDKNSRGSGSSGGSRRDNRLSRQSTGSHGSSHTSGIEADSRHRVSVEMSVDEPFGI
DRVHRKEKSCSSTISYGSSGIDSGSKGRAEDDSQDDDLELAVDEPEEVPVDEPLEGEQLE
EATVGESVESLPLDAASCQVINQESLPVVQVTLIKMRGQSVESLQQVKSPKGRSCTDQHS
QSLDDIRLYKHRHPPLSATLSSDTSHSYTFGCSLEDKLAVYGCVYSTADCKTKSALYGKR
SMNCLSLDLLGEDQLPEEFVV
Download sequence
Identical sequences G1NI43
ENSMGAP00000012904 ENSMGAP00000012904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]