SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013046 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013046
Domain Number 1 Region: 168-282
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.23e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 2 Region: 379-523
Classification Level Classification E-value
Superfamily PH domain-like 4.62e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 3 Region: 70-183
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000126
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 596-697
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000129
Family BCR-homology GTPase activation domain (BH-domain) 0.0048
Further Details:      
 
Domain Number 5 Region: 3-60
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000192
Family Pleckstrin-homology domain (PH domain) 0.00044
Further Details:      
 
Domain Number 6 Region: 500-601
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000209
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013046   Gene: ENSMGAG00000012390   Transcript: ENSMGAT00000013948
Sequence length 698
Comment pep:novel chromosome:UMD2:4:53350680:53402996:1 gene:ENSMGAG00000012390 transcript:ENSMGAT00000013948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVFSKGIILLSAIATVRVHGENKFEVVTSHRTFVFRVDKEEERNDWVDKILNAVKSQSDN
NPQSRISVAPEKSGYLELKGYKAKIFILLQGNTVWICKNEQDFKTGFGITLIPMNVANVK
QVDRTAKQSFEIITPYKSFSFTAESEKEKQDWIEALQESIAETLSDYEVAEKIWFNESNR
SCADCKAPNPDWASINLCVVICKKCAGQHRSLGPRDSKVRSLKMDASIWSNELIELFIII
GNKRANTFWAGNLPPDEELHMDAPAEKRIAFITQKYKERKFRKAPFPYKTKEQLNKHGKA
LCAAVVKQDVLETLMLLFSGADVMCATGDPVYSTPYLLAKKAGQRLQMEFLYHNKFSDFP
NFDTSFESGFSEDSSHSTFLCEFLYKVSSNSTKLLTEKKLKEDCNKRWCTLESGFLSYYE
NDKATTPNGMLDINEVICLVVHSSDYFLNRGDIFTFEIYLMSERVFLFGAETAYSQRKWT
WAIAKHFVPPVAECLLERDCDLIGQLYYKDCHNLDQWRKGWFAIEKSSLHFCLEMENAQE
DSIYLRRLQELTISSVMQNGEKIDVLLLVEKGRTLYIHGHTKLDFIVWYTAIEKAAGTDG
NALQDQQLSKNDVPIIVNSCIAFVTQYGLGSKHIYLKNGNSSNVAELLDSFKKDARSVKL
RAGKHRLEDVTDVLKSFLSQIDDAILTKELYPFWISAL
Download sequence
Identical sequences G1NIF5
ENSMGAP00000013046 ENSMGAP00000013046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]