SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013085 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013085
Domain Number 1 Region: 166-323
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 2.35e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 17-168
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.99e-64
Family DNA-binding protein LAG-1 (CSL) 0.0000105
Further Details:      
 
Domain Number 3 Region: 324-436
Classification Level Classification E-value
Superfamily E set domains 1.59e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013085   Gene: ENSMGAG00000012418   Transcript: ENSMGAT00000013987
Sequence length 493
Comment pep:novel chromosome:UMD2:4:56474711:56501032:-1 gene:ENSMGAG00000012418 transcript:ENSMGAT00000013987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPVFTRKFGERPQPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCV
YLMGSGWKKKKEQMERDGCNGCTEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYI
SDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALF
NRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLLDDDESEGEEFTVRDGYIHYGQTVKL
VCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQA
TPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVHAPVTPVPVVESLQLNGGGDVAM
LELTGQNFTPNLRVWFGDVEAETMYRCAESMLCVVPDISAFREGWRWVRQPVQVPVTLVR
NDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSLMASSETNANSEGSYTNVSTNPTN
VTSSTATTATVVS
Download sequence
Identical sequences G1NII9
ENSMGAP00000013085 ENSMGAP00000013085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]