SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013186 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013186
Domain Number 1 Region: 4-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.98e-58
Family IMD domain 0.0000539
Further Details:      
 
Domain Number 2 Region: 328-389
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013186   Gene: ENSMGAG00000012521   Transcript: ENSMGAT00000014088
Sequence length 531
Comment pep:novel chromosome:UMD2:1:50384841:50392380:-1 gene:ENSMGAG00000012521 transcript:ENSMGAT00000014088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGEMDLSYRSTISIYKSILEQFNPALENLVYLGNNYLRAFHALSKAAEVYFKAIEKIGE
QALQSSTSHVLGEILMQMSDTQRLLSSDLEVVVSGFPWGWLHAEDQSKMDVQFISESQKQ
YELEYRRKANNLEKCTAELWRMERARDKNVREMKENVMRLRSEMQAFLSNSQREAELEEK
RRYRFLADKHQMLYNTLLQFYSRARGMIQTKAPQWKEQLEASRNPSNSHVQGLLTSSHGQ
GYPSGRLTPTHLETQRPLGDFASSMAGSRSSIFSQEPPEMRLSPQPEVPRRPLQRTPSAS
LVPAGRVSRSGSFGEASSSSEGRRRGGTVRVQAIAPHTTGANRTLLRFDPGDVITVLMPE
AQNGWLYGKLEGSSACGWFPEAYVKPLEDARDMEEPPVRDVSVASTCAALHSLLFDSPLT
VISLRSFPLRSSHSMDDILDHPSVSSSSWSAAAQAAVPNPPPAPVGASSHQSGPVTSGGS
KVSAGGLTDVSGGWFTFEQYPPELFPRGTNPFATVKLRPTVTNDRSAPIIR
Download sequence
Identical sequences G1NIS7
ENSMGAP00000013186 ENSMGAP00000013186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]