SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013242 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013242
Domain Number 1 Region: 35-133
Classification Level Classification E-value
Superfamily DEATH domain 1.04e-20
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 
Domain Number 2 Region: 323-455
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000015
Family Tropomyosin 0.0042
Further Details:      
 
Domain Number 3 Region: 680-754
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000428
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013242   Gene: ENSMGAG00000012568   Transcript: ENSMGAT00000014145
Sequence length 1153
Comment pep:novel chromosome:UMD2:1:50133091:50144901:-1 gene:ENSMGAG00000012568 transcript:ENSMGAT00000014145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKHVSGINTLMLEFPVLRNGGIGEDVCLSEQEEEEDALWEKIESARHQLTRSLNPAKLTP
YLRQCRVIDEQDEEEVLNSCRFPCKSNQTGYLMDILRRRGKRGYEAFLESLEFYYPEHYT
RLTGREPAQRCSMILDEEGPEGLMQFLLVEVKKMRAQRKEHLLKEHQLQAKNQALEQEQA
RLEQRLQELLKVQDRCQRLREEWDSNSVELLRLKDENYMMAMRYAQLCEEKNMAVLRSRD
LQLLVDQLKCKVTSLEEECSLLRKQASTMPQREAEERGHPDAVSELWAENQRLTASLQEL
QGMLQAPGEVPVPGSEQILLDILEHDWKEAQDDRQDLCQKLNSLQSELQWAEELRDKYLQ
EVEDLQLKYRTLQKDCDLYKHRMNTVLLQLEEIEKERDQAIQSRDGVQLQYSQSLIEKDQ
YRKRVRALEEERDELLSKLSRVEGLNSTLEAQLQRCRGNRSLGKVSSAGEKTLPTPSAPT
SAAHGALWTSLLTLQVDSQTRWMFLPSPSQGTLPFRACPRRGLLTARRTSTVSLPSPSLL
ALAPSFGGSVKIGNGFVSIPPGAFSSSSSSTYTRVKSETCLSMLTSHQEISRRYFLQEED
HDPLFGGMYPGAEESCPGGCLSCKSFPDSKGEDKHIGFSGVERHKSELQLLVFLLARSLV
VQLTSMGHPSSLSPHEKRLGADISILGGNRTGIYVQWVKPGSQVESIGLREGCRLIELRV
PSLKEEVLSLENCTREVAYLSLLHWDEPSSLVFQLDLQGYQPLREALEEGKKFSGDSFYI
RTNLSLLEPSDPYALCVKCREILHVTDTMYKGRLEWYCSRVDPLTMRDLDKGTVPNYSRA
HQLLKIQEKVHIPGQQRGQRSNVSQRSQQGIQPSPERTSTQWDALVSPARALLTALLREE
ITMVPRSLLVSNSSEAQEMGRVSPGDVRCVVGVLMSDDKRMVQEELNGLWDDGRLYSDRS
LKPYSLVHPVVVKTPRPVVLSPSCIAPRLIRNLLDLPTSRLNFHVCPADSVFTQDKFYFL
PPSSSFSHLSPFPCLEFTLCQLQERKNKHCLLELGVQSVRDLIKREIYPIVIHVEVTEKN
IRGLRSLLGHPGQRDAEVLKACRGAERALHALPCSWARVEPHAWSHAEELPKVVRGCIFQ
EQNRPLWVEDGDD
Download sequence
Identical sequences G1NIX2
ENSMGAP00000013242 ENSMGAP00000013242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]