SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013294 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013294
Domain Number 1 Region: 289-473
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000326
Further Details:      
 
Domain Number 2 Region: 81-204
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-21
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013294   Gene: ENSMGAG00000012621   Transcript: ENSMGAT00000014198
Sequence length 475
Comment pep:novel chromosome:UMD2:7:34540045:34871426:1 gene:ENSMGAG00000012621 transcript:ENSMGAT00000014198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSATSDMASEKPNPSHSTGAVQMRIKNANSHHDRLSQSKSMILSENVKVLEPINRHRR
NHSQHNLTLADIISTPDHTVVEKEGYLLKAKIADGGKKLRKNWSTSWIVLTSRKMEFYKE
SKQPALANLKPGYKPECVDLCGARIEWTPEKSSRKNVFQITTVSGNEFLLQSDIDFLILD
WFHAIKNAIDRLPKERSYTSRNLEFKLRRSSSTELLNSLDTESKESKPEHRKSLIFRLNY
SASDSNDRNRVKSRLKKFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQ
CIKAVEKRGLEVDGIYRVSGNLATIQKLRFVVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYCFFEQFVEAIKIQDNATRIKAVKTLVKKLPRPNYDTMEVLFEHLKKIAAKE
SVNLMSTQSLGIVFGPTLLRPEKETGNMAVHMLYQNQIVELMLSEYSKIFGSEED
Download sequence
Identical sequences G1NJ18
ENSMGAP00000013294 ENSMGAP00000013294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]