SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013769 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013769
Domain Number 1 Region: 948-1251
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.92e-86
Family Complement components 0.0000577
Further Details:      
 
Domain Number 2 Region: 1322-1452
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.14e-36
Family Alpha-macroglobulin receptor domain 0.0000433
Further Details:      
 
Domain Number 3 Region: 777-897
Classification Level Classification E-value
Superfamily E set domains 3.92e-24
Family SVA-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013769   Gene: ENSMGAG00000013050   Transcript: ENSMGAT00000014684
Sequence length 1456
Comment pep:novel chromosome:UMD2:1:80052367:80088579:-1 gene:ENSMGAG00000013050 transcript:ENSMGAT00000014684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIHLSCCLRVILPSVVTLSWIVAVSSELQYVLLVPTVVRSNSPQTACVQFQSLSEPLSL
SVVLEYSNIQTTLFEEFVTKNDYFTCCDFKVPPATSDPLAFISFSAKGNTVNLTERRSVA
IENVYNTLFIQTDKPIYKPGQKVMFRVVTLDSQFRPVQETYPRIIIKDPEQNQIFQWLDV
SSMHGIIQLSFPLIEEPVLGSYHIIVEKKSGDKEHEYFTVDEYVLPKFEVTTSMPRRISF
FDEEIRVNVCALYTYGQPVQGIARINVCQQHFYNPRCQQSQKPTCEAVTGLLENNGCLSS
VVSTKTFQLYRSYTRMYASLNIETIITENGTGIQMKNYDYVAVSQENDRVMFRNMDQYYR
RGIPYFGEITVTNADGKPVASRVVVLEVNGEYEANYTTDENGTAAFSIDTSNFFSPSVKL
SATQAPDGCADFFMWRNDHESQALFFVHRFYSRTNSFVRIEPVKEKLSCGQQRMINIHYV
LSRKGYRNATHTNFYYVVMTKGKIVLSGQKQVRITHASTAPWGTFAITLIVTEELAPSAR
LLLYTVHPNGEIVADSSWIQSDICFKNKLQFEFSEKQALPGSKINIRLEAAANSYCALQA
VDQSVFLLQPERELSAESVYYQLHLSDLYGYYYNGLNLQDDQPGLYYEPVNVSHDGDVYR
IFREMGLKVFTNSTLRKPVLCNEDRLDWEDNRIYLEDENSAPVYLSGQESSKIAAAGPIN
TVRKYFPETWIWDLVRTDSTGEANVFYTIPDTITEWKAGAFCLQDDAGFGISSPVSLTAF
QPFFVDLALPYSVIRGEIINLIANIFNYLDKCIQISAILAESSDYKVEVLSPEVNTARVC
ANERKTYIWAASLLSLGEVKFTITAEAKLNTKAAKNSTPAEEETIRTDTLTQMLLVEPEG
VKKELTQSSLICTKGTTVSEPVLLNLPRNVVQGSARVYFSVIGDILGTALRNMENLLHMP
YGCGEQNMALFTPNIYALDYLNKTGQLTEEIRVKSTGYLTTGYQKQLSYKHQDGSYSSFG
TRDKEGNVWLTAFVYKSFAQARRYIYIDENVQSQTLIWLARKQKSDGCFENAESHFNNAL
KAGEEGEYSLTAYIVAALLEAGHSVRHPVVWSGMNCLETAFSNGVHNLYNHALFAYVYGL
ADKQERYQYFLEKLDKRATRSDGSVYWQRENKPPAEHFPAFYSRAPSAEIEMTSYVLLAL
LNKAKLTPDDLSYISRIVYWLVKQQNPYGGFSSSQDTVVALQALAQYGYLTFSKESRNTI
KVSFMEIPKKAFQVNDKNRFLLQQTSLPIVPGNYSVEVYGTGCVYMQTTLRYNIHLPKKA
AGFFLSVESANVSCTSNFPPKFDLVFSASYTGNRNVSNMAIVDVKMLSGFNPDRSSLKKS
LQYQPSVVDHVDIKNDHIFFYLQKVGLEKEISFSFSVEQSLPVSNIKPAPVHIYDYYETD
EYAFVEYNTPCSPPSN
Download sequence
Identical sequences G1NK51
ENSMGAP00000013769 ENSMGAP00000013769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]