SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013858 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013858
Domain Number 1 Region: 594-836
Classification Level Classification E-value
Superfamily VPS9 domain 7.19e-46
Family VPS9 domain 0.0013
Further Details:      
 
Domain Number 2 Region: 55-177
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000027
Family SH2 domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013858   Gene: ENSMGAG00000013132   Transcript: ENSMGAT00000014776
Sequence length 953
Comment pep:novel chromosome:UMD2:5:46850341:46905330:1 gene:ENSMGAG00000013132 transcript:ENSMGAT00000014776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSARDEGARDDSGPSSDTSEEGKETHLCQATSLRNCLSLSGVSILDKLIKTCPVWLQL
NMNQERAAAILGNEAAGMFLVRKDSNANNMVLVVRMPVQSDAPGVLEYNIKEEKSILYLE
GSVLVFEDVFKLVAFYCVSRDLLPFTLKLPQAILEARSFQDLEIISSLGTDFWDSSLNHR
MSTEALSHPATDSALSTAQADGLRSTQCVASSANHCSCEIELSIGNDRLWFVNPIFIEEC
SNPFHPDSPPPKGHAVCSSLPPATTTSPRRPPPPPPHSHGQKSSLKLPWEPMTACEETQL
LQPLGKSIKEMKTVGGDGEEGKQSCSDKEPLAGSLKKGPQPAVPPRRRPSERAAEESCTG
KPASCETPKGEQTEEKQELDTQRKAAEMPGEVPEQAVSQFQEAKPEPAEKESMPEVQSDA
TEKGKLPPIPPPRRKRLSQAPQVLSSCQSNHRTVVEQPAVTAQAQGTDCSASAAGAATGT
NAETEQGCGRKSVNSAELKGSHLSLEGLGGSAAAQTSASEPDSYSTSSTEDDLEMLATSS
TKKDSMILGKAKNRLSFVSLSNVFTVFLSNDRKLQKKIVELAQDKDSYFGNLVQDYRVYS
LEMMAKQSSSTEMLQEIRMMMTQLKSYLVQSTELKSLIDPAAYTDEQLDMIAESALYKCV
LKPLKEAINSHLKEIHNKDGSLQQLKENQLVIQNTTTTDLGVTTSVPETVVLDKILHKFT
TMHKAYSPEKKIGILLKSCKLIYDSMSQGNPGKPYGADDFLPVLMYVLARSNLTEVLLNV
EYMMELMDPALQLGEAGSYYLTTTYGALEHIKNYDKITVTRQLSVEVQDSIYRWERRRTL
NKARASRSSVQDFISISFLEIGAQSRTLASRNDTTTEQLCQQCAEKFEVSHPKIYRLFVY
VDGQWLQLDKEALPHRIKASLLKSENKKDFHFIYKPIEYKNPPVPIVRETDFS
Download sequence
Identical sequences G1NKC4
ENSMGAP00000013858 ENSMGAP00000013858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]