SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000013890 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000013890
Domain Number 1 Region: 38-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000503
Family V set domains (antibody variable domain-like) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000013890   Gene: ENSMGAG00000013164   Transcript: ENSMGAT00000014809
Sequence length 150
Comment pep:novel scaffold:UMD2:GL429325.1:1:923:-1 gene:ENSMGAG00000013164 transcript:ENSMGAT00000014809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSPALLLLLSLGLCCAGTQGQRDAFVVRFPNRRIIQPQEGQRLELDCWRNKTSWKVSW
IRLDKDGNLHFILSITHSHSSTMQESEKTATNFEALWRGNSYRLVVKSFRAQDQGIYFCV
NYINPGLHFSSGQPAFFPASPTSLTPTTPA
Download sequence
Identical sequences H9H1W9
ENSMGAP00000013890 ENSMGAP00000013890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]