SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014258 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014258
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily PX domain 4.19e-25
Family PX domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014258   Gene: ENSMGAG00000013494   Transcript: ENSMGAT00000015186
Sequence length 108
Comment pep:novel chromosome:UMD2:2:69889276:69893504:1 gene:ENSMGAG00000013494 transcript:ENSMGAT00000015186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNLPIFKLKESTVRRRYSDFEWLRNELERESKVVVPPLPGKALLRQLPFRGDDGIFDDSF
IEERKQALEQFINKVAGHPLAQNERCLHMFLQDEVIDKNYTPSKIRHT
Download sequence
Identical sequences A0A094L6W5 G1NL86
ENSMGAP00000014258 ENSMGAP00000014258 XP_008930935.1.96775 XP_009498888.1.22320 XP_009967188.1.75343 XP_010012255.1.70042 XP_010079996.1.40768 XP_010115493.1.88979 XP_010205552.1.23224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]