SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014274 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014274
Domain Number 1 Region: 240-442
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.22e-31
Family Sec63 N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 100-202
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.88e-25
Family Chaperone J-domain 0.00089
Further Details:      
 
Domain Number 3 Region: 454-478,632-716
Classification Level Classification E-value
Superfamily E set domains 3.5e-24
Family Sec63 C-terminal domain-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014274   Gene: ENSMGAG00000013499   Transcript: ENSMGAT00000015202
Sequence length 757
Comment pep:novel chromosome:UMD2:2:69994228:70032128:1 gene:ENSMGAG00000013499 transcript:ENSMGAT00000015202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAGQKFCTSFSPIYFYFFAFFFSCIKTVLLFFSYTVDVSTEQIRLKNIRNVYGRCLWYRL
RLLKPQQNIIPTVKKIILLAGWALFLFLAYKVSKTDREYQEYNPYEVLHLDPGASISEIK
KQYRALSLKYHPDKGGDEVMFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALPA
WIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRNM
DMKRLIMVLAGASEFDPQYNKDATSRPADNVQIPQLIREIGGINLKKNEPPLTCPYSLKA
RVLLLTHLARMKVPDTLEEDQQFILKKSPALLQEMINVICQLIIMARSREEREFRAPSLG
SLENCMKLSQMTVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKSIQDLVSLKGSDRR
NLLHFLEDKKYDEVMAVLGSFPYVTMDIKPQVLDDEDSNNITVGSLVTVLVTLTRQTMAE
VFEKEQSICSAEEQPAEDGQGDSNKVKSKGWQQKNKGTKKASKSKKKKPLKKKPVPPSLQ
PPKQQKQKQANGVAHKEVVVKEEEEDISDKGSESEEEETNRDSQSEKDDGSDRESDREQD
EKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLFFPEEKQEWWWLYIADRKEQM
LICMPYHVCTLKDKEEVELKFPAPGKPGNYQYTVYLRSDSYMGLDQIKPLKLEVHEAKPV
PENHPQWDTAIEGDEDQEDSEGFEDSFEEEEEEEDDD
Download sequence
Identical sequences G1NL97
ENSMGAP00000014274 ENSMGAP00000014274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]