SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014459 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014459
Domain Number 1 Region: 731-1092
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.12e-103
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000000000553
Further Details:      
 
Domain Number 2 Region: 529-728
Classification Level Classification E-value
Superfamily ARM repeat 6.91e-62
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000826
Further Details:      
 
Domain Number 3 Region: 351-527
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-53
Family PLC-like (P variant) 0.00000016
Further Details:      
 
Domain Number 4 Region: 147-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-52
Family Ras-binding domain, RBD 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014459   Gene: ENSMGAG00000013678   Transcript: ENSMGAT00000015395
Sequence length 1106
Comment pep:novel chromosome:UMD2:1:14397136:14427590:1 gene:ENSMGAG00000013678 transcript:ENSMGAT00000015395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGDYEQPVVMREENKRRRRRMKPHCTSSNLSSMELISIEFILPTSNKHTKVPEMMLLE
IAGNCTVEQMKAQIWMRAIEMSQTTDFYHAFTPDQFVLQYQKKGQWYEIYDKHQLLQTLD
CILYWKVLQKKVGKIYVVQKQKPSEEVQEFQRQLNDLIGYDVTDVSNVHDDELEFTRRRL
VTPRMIEVACRDPKLYAMHPWTTSKPLPEYLFKKITNNNIFIIIHRGTTSQKIKVSIDDT
PDMILHSFFTKMAKKKSLMDIPEDHSELDFVLRICGRDEYITGDTPIKDFHWIRQCLKNG
EEIHLVLDNPPDPSEDEVQKEEWPLVDDCTGVTGYHEQLTIDGKDHERVFTISLWDCNRK
FRVKIIGIDIPVLPRNTDLTVFVEANIQHGQQLLSQRRTSSKPFTEEVLWNIWLEFDIKI
KDLPKGALLNLQIYCGKAQGLSTKTNLQSHESPNSDSKCKTQLLYYVNLLLIDHRFLLRS
GEYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAISIVLDKYCHPIALPKHRITSD
SQGDRTRAEMPNQLRKQLEEIIATDPLNPLSPEDKELLWHFRYESIKHPKAYPKLLSSVK
WGQQEIVAKTYQLLAKKEAWDQSTLDVGLTMQLLDCNFSDENVRAMAVQKLESLEDDDVL
HYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSMHYQQRFAVIL
EAYLRGCGKAMLHDFMKQVQVIELLHKVTMETKSVSAEKYDVTSQVIAQLRQKLEKLQGS
KLPESFRVPYDPGLRAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDD
LRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKIGMIEIVKDATTIAKIQQSTVG
NTGAFKDEILNQWLKDRCVIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITET
GNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFHKFQDVCVKAY
LALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKHFLDQIEVCRD
KGWTVQFNWFLHLVLGIKQGVEKHSA
Download sequence
Identical sequences G1NLQ0
ENSMGAP00000014459 ENSMGAP00000014459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]