SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014461 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014461
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-31
Family Ras-binding domain, RBD 0.00000534
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000014461
Domain Number - Region: 147-345
Classification Level Classification E-value
Superfamily Tropomyosin 0.00412
Family Tropomyosin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014461   Gene: ENSMGAG00000013685   Transcript: ENSMGAT00000015397
Sequence length 419
Comment pep:novel chromosome:UMD2:1:72705591:72720085:-1 gene:ENSMGAG00000013685 transcript:ENSMGAT00000015397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPI
VSLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQTDKAM
KRREPKRKSLTFTGGAKGLMDIFGKSKESEFKQKVLNNCKTTADELKKLIHLQTEKLQCI
EKQLESNEAEIRYWEQKYNASLEEEILKLEQKIKRNEVEIEEEEFWENELQIEQENEKQL
KEQLQEMRQRILECEGKLKDYMSQIHNMESGLEAEKLHREVQESQVNEEEVKEKIEKVKG
EIDIQGQQSLRLENGIKAVERSLGQATKRLQDREQELEQLTKELRQVNLQQFIQQTGTKV
TVLPADPVEVEAPPVELEREPTFQSGSLKRPGSSRQLPSNLRILQNPLSSGFNPEGIYV
Download sequence
Identical sequences G1NLQ2
XP_003202589.1.16129 XP_019472314.1.16129 ENSMGAP00000014461 ENSMGAP00000014461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]