SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014639 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014639
Domain Number 1 Region: 662-792
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.12e-31
Family Synaptotagmin-like (S variant) 0.00000226
Further Details:      
 
Domain Number 2 Region: 515-624
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-19
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 3 Region: 17-104
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.12e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014639   Gene: ENSMGAG00000013836   Transcript: ENSMGAT00000015576
Sequence length 1298
Comment pep:novel chromosome:UMD2:2:85975213:86098416:-1 gene:ENSMGAG00000013836 transcript:ENSMGAT00000015576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLHQQFESYKEQVRKIGEEARRYQGEHKDDAPTCGICHKTKFADGCGHLCSYCRTKFCAR
CGGRVSLRSNNEDKVVMWVCNLCRKQQEILTKSGAWFFGSGPQPSPSQDGTLSDTATGAS
SDAPREKKARLQERSRSQTPLSTAAASSQEISPSTVQSDRRKGAEVSQPAMGLEQKQVSS
RSRSEPPRERKKTLVSDQNGKVVKGERKRVPKTSLQKEGPTDDRERKERHENRRLEKGKS
QDYPDLPEKLEEGKVPDDEKQRKEDEYHTRYRSDPNLARYPVKPHPEEQQMRMHAKVSKA
RHERRHSDVALPHTEMEEAEVPENNLGKRSQLQGTQDRKSLVETQRSYSIDRTGDVRISV
SKQLTNHSPPTPRHSPVPIEHVEYKNHDTFKKQSRLDPSSAILMRKAKREKMETMLRNDS
LSSDQSESVRPSPPKPHRAKRGGKKRQMSVSSSEEEGASTPEYTSCEDVEIESESVSEKG
DLDYYWLDPATWHSRETSPISSHSILTWQPSKEGDRLIGRVILNKRTTMPKESGALLGLK
VVGGKMTELGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILES
KSEPQVEIIVSRPIGDIPRIPESSHPPLESSSSSFESQKMERPSISVISPTSPGALRDAP
QVLPGQLSVKLWYDKVGHQLIVNVLQATDLPPRVDGRPRNPYVKMYFLPDRSDKSKRRTK
TVKKSLEPKWNQTFLYSHVHRRDFRERMLEITVWDQPRVQEEESEFLGEILIELETALLD
DEPHWYKLQTHDESSLPLPQPSPFMPRRHVHGGDSSSKKLQRSRPISDSDISDYDVDDGI
GVVPPVGYRSSTRESRSTTLTVPEQQRTTHHRSRSVSPHRGDDQGRTRSRLPNVPSQRSL
DEIHQMRRSRSPTRHHEASRSPADYRSRDMDSQYLSDQESELLMLPRAKRGRSAECLHTI
RSSVRHYKTLPPKMPLLENGIHWNLYSSTLPACAKTKSVVRQDISLLRDCLNSRIPKFGD
DLLVSELQPSLDRARSASTNCLRPDTSLHSPERERGRWSPSLERRRPTSPRIHIQHASPE
DDRQSRKVERYSSQKQTRKGSAAETERGLLPCLSRRGLPAPRTTEQPVIRGKHHARSRSS
EHSSVRALCSVHHLAPGGSAPPSPLLTRIHQQGSPTQSPPADTSFSSRRGRQLPQVPVRS
GSIEQASLVVEERTRQMKMKVHRYNQTSGSGSSQEHEREQYTKYNIQTDQYRSCDNVSAK
SSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRI
Download sequence
Identical sequences G1NM50
ENSMGAP00000014639 ENSMGAP00000014639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]