SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014662 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000014662
Domain Number 1 Region: 2-316
Classification Level Classification E-value
Superfamily Sema domain 4.45e-132
Family Sema domain 0.00000000000732
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014662   Gene: ENSMGAG00000013860   Transcript: ENSMGAT00000015599
Sequence length 317
Comment pep:novel chromosome:UMD2:1:72504474:72546304:-1 gene:ENSMGAG00000013860 transcript:ENSMGAT00000015599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPRFISAHLIPESDNPEDD
KIYFFFRENAIDGEHTGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNGI
DTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAVCMYSMTDVRRVFLGPYAHRDG
PNYQWVPYQGRVPYPRPGTCPSKTFGGFDSTKDLPDEVITFARSHPAMYNPVFPINNRPI
MIKTDVDYQFTQIVVDRVDAEDGQYDVMFIGTDIGTVLKVVSIPKETWHELEEVLLEEMT
VFREPTVISAMKISTKQ
Download sequence
Identical sequences G1NM69
ENSMGAP00000014662 ENSMGAP00000014662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]