SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000014923 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000014923
Domain Number - Region: 100-163
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0216
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 21-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.034
Family RecQ helicase DNA-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000014923   Gene: ENSMGAG00000014106   Transcript: ENSMGAT00000015865
Sequence length 203
Comment pep:novel chromosome:UMD2:1:80812035:80814778:1 gene:ENSMGAG00000014106 transcript:ENSMGAT00000015865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTYADYLAEAANLPPLTEAQKNKLRHLSVVTLAAKIKCIPYSVLLEQLQLKNVRQLEDLV
IEAVYADVLRGSLDQRNQRLEVDYSIGRDIRREELSTITRTLQEWCQGCEVVLSGIEEQV
SRANQHKEQQLALKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQR
QTSKKTSKAKGLRGSAKIWSKSN
Download sequence
Identical sequences G1NMU0
ENSMGAP00000014923 ENSMGAP00000014923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]