SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015407 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015407
Domain Number 1 Region: 16-164
Classification Level Classification E-value
Superfamily E set domains 0.0000273
Family Arrestin/Vps26-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015407   Gene: ENSMGAG00000014550   Transcript: ENSMGAT00000016363
Sequence length 308
Comment pep:novel chromosome:UMD2:1:112773613:112789652:-1 gene:ENSMGAG00000014550 transcript:ENSMGAT00000016363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQGPLLSRQGAMGTALDIKIKRANKVYHCGEILSGVVVITSKDTVQHQGISLTMEGSVNL
QLSAKSVGVFEAFYNSVKPIQIINSTIEMVKPGKLPSGKTEIPFEFPLHVKGNKVLYETY
HGVFVNIQYTLRCDMRRSLLAKDLTKTCEFIVHSVSQKGKLTPSPVDFTITPETLQNVKE
RASLPKFLIRGHLSSTNCIITQPLTGELVVESAEAAVKSIELQLVRVETCGCAEGYARDA
TEIQNIQIADGDVCRGLPIPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHDDHLITEN
FPLKLCRM
Download sequence
Identical sequences G1NNY7
ENSMGAP00000015407 ENSMGAP00000015407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]