SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015464 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015464
Domain Number 1 Region: 21-122
Classification Level Classification E-value
Superfamily Immunoglobulin 4.59e-16
Family V set domains (antibody variable domain-like) 0.0091
Further Details:      
 
Domain Number 2 Region: 108-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000323
Family I set domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015464   Gene: ENSMGAG00000014597   Transcript: ENSMGAT00000016420
Sequence length 294
Comment pep:novel chromosome:UMD2:1:116275741:116283206:-1 gene:ENSMGAG00000014597 transcript:ENSMGAT00000016420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSYRFLLLFLHILRAVTALEKIISKPGDNVRLSCIYPGREFSLDNLRVYWQIADDEDTE
PCSVVHALISGQDNESLQCSQFKNRTQLFWDKLGDGNFSLLLFNVRQSDEHTYRCIVMQT
IEYTRVIHQEQVVLSLAASYSQPILSGPKRNSYNTGEEVTFSCRSDNGYPEPNVYWINRT
DNTRLSQSDFNITQHPNGTYSVLSTLKVKATSDMQIECFIENKILQENTSANYTEEMQIN
GSSTGSHKDQAKSGQGAQAAAVVSVVILMAFLSVLICWLWKRRSSQLVSYTAPI
Download sequence
Identical sequences G1NP31
ENSMGAP00000015464 ENSMGAP00000015464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]