SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015504 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015504
Domain Number 1 Region: 2764-2887
Classification Level Classification E-value
Superfamily EF-hand 1.06e-52
Family EF-hand modules in multidomain proteins 0.000000603
Further Details:      
 
Domain Number 2 Region: 2889-2992
Classification Level Classification E-value
Superfamily EF-hand 3.26e-36
Family EF-hand modules in multidomain proteins 0.00000374
Further Details:      
 
Domain Number 3 Region: 677-833
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-27
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 4 Region: 1742-1890
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 5 Region: 2973-3060
Classification Level Classification E-value
Superfamily RING/U-box 2e-20
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 784-944
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-20
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 7 Region: 2430-2556
Classification Level Classification E-value
Superfamily Spectrin repeat 9.24e-20
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 8 Region: 22-128
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-19
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 9 Region: 894-1048
Classification Level Classification E-value
Superfamily Spectrin repeat 9.68e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 10 Region: 2580-2718
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-17
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 11 Region: 2316-2446
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-17
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 12 Region: 203-345
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-17
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 13 Region: 1200-1355
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-16
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 14 Region: 1505-1648
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000013
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 15 Region: 457-614
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000384
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 16 Region: 2148-2257
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000968
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 17 Region: 1330-1453
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000131
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 18 Region: 2726-2763
Classification Level Classification E-value
Superfamily WW domain 0.0000000000445
Family WW domain 0.00014
Further Details:      
 
Domain Number 19 Region: 1883-1998
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000736
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 20 Region: 1966-2096
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000329
Family Spectrin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015504   Gene: ENSMGAG00000014636   Transcript: ENSMGAT00000016461
Sequence length 3348
Comment pep:novel chromosome:UMD2:1:121975595:122727085:1 gene:ENSMGAG00000014636 transcript:ENSMGAT00000016461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFLETVEKRTYTTTVMRSEMDLDSYQTALEEVLTWLLSAEEALQAQGDISSDVEVVKEQF
HTHEGFMMELTAHQGRVGNVLQVGSQLLTIGKLSDDEENEIQEQMNLLNSRWESLRVASM
EKQSNLHKILMDLQNQQLAQLADWLVKTEERTKRIDSEPLGPDLEDLKRQVEEHKAFQDD
LEQEQVKVNSLTHMVVVVDENSGDKATAALEEQLQHFGSRWAAICRWTEDRWVLLQDILR
KWQHFAEEQCLFDAWLSEKEDALSKIQTSDFKDENEMLTSLRKLAILKGDIEMKRQMMSK
LKSLSKDLLVAVKNKAVAQKLESRLENFAQRWDSLVQKLESNSKQVSQAVTTTQTSLTQT
TVMETVTMVTTREQILVKHAKEELPPPPPHKKRQLLVDSEIRKRFDSDTTELHSWMTRSE
AVLQSPEFAIFRKEGNLSDLRERVNAIQREKPEKYRKLQDASRSAEALVEQMVNEGLNAD
NIKQASEQLKSRWIEFCQLLSERLAWLEYQNSIIDFYSQLQQLEQTAITAENWLKAQPTP
ATDPATVKIQLEKCKDEIIRMSTLQPQIERLKAQSQILKEKEGSPVFLDADLAAFTSHFK
QILADMHTREKQLQTIFDSLPPARYKDTVTTILSWIQQSETKVSVPPVAVAEYEIMEQRL
LELKALQSSLQEQQKGLNYLNATVEDLSRKAPAEVSQKYRSEVELIIGRWKKLSSQLVEH
CQKLEDLMTKLQRFQNDTKTLRKWMAEVDVFLKEEWPALGDSEALEKQLEQCTALVNDIQ
TIQPSLNSVNEIGKKMKREAEPEFASRIATELKDLNAQWEHICQQAHAKKAALKGGLDKT
VSLRKDLSEMHEWITQAEEEYLERDFEYKTPDELQKAVEELKRAKEEAMQKEVKVKLITD
SVNNFIAKAPPAANEALKKELDVLITSYQRLCSRLNGKSKTLEEVWACWHELLSYLDAEN
KWLNEVELKLKATENIQGGAEEISESLDSLERLMRHPEDNRNQIRELAQTLTDGGILDEL
INEKLEKFNTRWEELQQEAVRRQKSLEQSIQSAQETDKTLRLIQESLAAIDKQLTAYIAD
RIDAAQVPQEAQKIQSELTSHEISLEEMKKRNRGKESAKRVLSQIDVAQKKLQDVSMKFR
LFQKPANFEQRLQECKRILDEVKLQVPKLETKSVEQEVVQSHLDHCMKLYKSLSEVKSEV
ETVIKTGRQIVQKQQTENPKELDERLTALKLQYNELGAKVTEKKQELEKCLKLSRKLRKE
INSLTEWLAATDVELTKRSAVQGMPSNLDAEIAWGKATRKEIEKRQVQLKNISDLGENLK
TVLKGKEGLVEDKLSLLNSNWIAVTSRAEEWLNLLMEYQKHMEAFDQKVANVTTWMYRAE
ILLDESDKQKPHQKEETLKRLKAELNDMHPKVDSVRDQAVDLMTNRGDHCRKVIEPKLSE
LNHRFAAISQRIKSGKPFIPLKELEQFDFDIQKLLEPLEVEIQQGVNLKEEDFNKDMSED
DESTVKELLQRGDTLQKRITDERQREEIKIKQQLLQSKHNALKDLRSQRRKKALEISHQW
YQYKRQADDLMTWLDDIEKKLASLPDHKDEQKLKEIGGELEKKKEDLNAVNRQAERLSKD
GAAKAVEPTLVQLSKRWQDFESKFAQFRRLNYAQIQTVHEDTTFVMTESMTVETTYVPST
YLAEILQLLQALSEVEERLNSPVLQAKDCEDLLKQEECLKNIKDRLGRLQGQIDIIHSKK
TPALQSATPRETANIQEKLTQLNSQWEKVNKMYRDRQARFDKSMEKWRLFHCEMKSFNEW
LTETEEKLSRAQIEAGDVGHVKTKQFLQELQDGIGRQQTVVKTLNVTGEEIIEQSSAADA
NVLKEQLGNLNTRWQEICRQLVEKKKRIEEEKNILSEFQEDLNKVILWLEETESIIAIPL
EPGNEDQLRDCLGKVKLRVEELLPHKGILKRLNETGGTALGSASLNPERKHKLESTLKET
GRRLLKVSRDLPEKQKEIEILLKDFIDLDQQINQLTLWVTPVKNQLELYNQVGQPGAFDI
KETEAAVRAKQPNVEEVLSKGCHLYKEKPATHPVKKKLEDLNADWKAINLLILQLKEKPT
FGEPALSSPGVLTSGQTVAVDTQTRVTKETTSSTPEMPSSVVLEVPALADFNKAWAELTD
WLSRLDREIKAQRVTVGDLDDINDMIIKQKAILQDLEQRRPQLDELITAAQNLKNKTSNQ
EARTIITDRIEKIQSQWDVHGYLQNTTAXRIQQLHEMLKDSTQWLEAKQEAEQVLEQAKA
KLESWKEISYTVEALKKQNTELKQFSKEIRQWQMNIEIVNDVALKLLRDYSADDTRKVEL
MTDNINATWATINKRVSEREAALESALLMLQEFYLDLEKFLAWLTEAETTANVLQDATRK
EKTLEDPQMVRELMKQWQDLQAEIDAHTDIFHNLDENGQKILRSLEGSEDAVLLQRRLDN
MNFRWSELRKKSLNIRSHLEASTDQWKRLHLSLQELLAWLQLKEDELKQQAPIGGDLPTV
QKQNDAHRTFKRELKTKEPVIMSALETVRLFLADQPVEGLEKVYPEPRELSPEERAQNVT
KVLRRQADDVRTEWDKLNLRSADWQKKIDDALERLQGLQEAMDELDLKLRQAEAFKGSWQ
PVGDLLIDSLQDHLEKVKVYRAEMVPLKEKVHQVNELAHRFAPPDIQLSPYTLSCLEDLN
TRWKVLQVAIDERIRQLHEAHRDFGPTSQHFLTTSVQGPWERAISPNKVPYYINHETQTT
CWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLNLSAACDALDQHNLKQN
DQPMDILQIINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKT
GVVSLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEP
SVRSCFQFVSSSPEIEAALFLDWMRLEPQSMVWLXQSMVWLPVLHRVAAAETAKHQAKCN
ICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAK
VLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSALAEMENTNGSYLN
DSISPNESIDDEHLLIQHYCQSLNQESPLSQPRSPAQILISLESEERGELERILADLEEE
NRNLQAEYDRLKQQHDHKGLSPLPSPPEMMPVSPQSPRDAELIAEAKLLRQHKGRLEARM
QILEDHNKQLESQLHRLRQLLEQPQADAKVNGTTLSSPSTSLQRSDSSQPMLLRVVGSQT
SETMGEDDLLSPPQDTSTGLEEVMEQLNNSFPSSRGRNAPGKPVREVS
Download sequence
Identical sequences G1NP65
ENSMGAP00000015504 ENSMGAP00000015504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]