SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015530 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015530
Domain Number 1 Region: 260-305
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000306
Family HtrA-like serine proteases 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015530   Gene: ENSMGAG00000014658   Transcript: ENSMGAT00000016487
Sequence length 525
Comment pep:novel chromosome:UMD2:1:126267170:126298054:-1 gene:ENSMGAG00000014658 transcript:ENSMGAT00000016487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPIPVVVCVLGGWCAIYLVDTLLKSSSSLKASYEDWLVNYGLSVSPFHMRWQTALFNRQ
FYNWGRWKPRFLYLWFSMGMVFGIAAMFGSVILLGKTLMQILTQMLTEAPTAQNDRMLQV
VVSVFSSARSFNCKLAVSLHSNQGQLSCPHEQVPGVNLPVSQLTYFFSAILISGVIHEVG
HGVAAIREQVRFNGFGIFIFIVYPGAFVDLFTTHLQLISPVQQLRIFCAGVWHNFVLGVV
SFMVLFLLPAFLFPFYYTGVGALVTEVTEDSPANGPRGLFVGDIVTSLQDCPIYGVEDWN
SCLGDFSQKSQIGYCINAATLQQLSFPARVYRRLDGTVECCSNSSLTDICFSYSNNLDSL
RYVCLPARKVIEASKVCRTNADCQKDVVSSFCVTPSLENQTRLFRVKHPPHMDMLFVGHP
MHLQYTVSLSSFVPRHNFLSIDLPVVIERFCKYLISLSGALAVINAVPCFALDGQWILNS
FLEATLSSLIVEKQNRELVGFLILLAGSTLLAANVALGLWMVTAR
Download sequence
Identical sequences G1NP88
ENSMGAP00000015530 ENSMGAP00000015530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]