SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015585 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015585
Domain Number 1 Region: 211-407
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015585   Gene: ENSMGAG00000014711   Transcript: ENSMGAT00000016543
Sequence length 768
Comment pep:novel chromosome:UMD2:1:132386469:132440613:1 gene:ENSMGAG00000014711 transcript:ENSMGAT00000016543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDFTWNSMSGRSVRLKSVPVQSLSELERARLQEVAFYQLQQEYDLGCQITIPKDGQKRKK
SLRKKLDSLGKEKNKDKAEFIPQAFGMPLSQVIANDRAYKLKQDSQREEQRDVSDFVAFL
LPFGAKRQNKELSSSNSSLSSTSETPNESTSPNTPEPAPRARRRGAMSVDSITDLDDNQS
RLLEALQLSLPAEAQSKKEKARDKKLSLNPIYRQVPRLVDSCCQHLEKHGLQTVGIFRVG
SSKKRVRQLREEFDRGIDVVLDEEHSIHDVAALLKEFLRDMPDPLLTRELYTPFINTLLL
EPDEQLSTLQLLIYLLPPCNCDTLHRLLQFLSTVAGHAEDTTDKDGQEVTGNKMTSLNLA
TIFGPNLLHKQKSTDKEFTVQSSARAEESTAIIAVVQKMIENYEALFMVSPDLQNEVLIS
LLETDPDVVDYLLRRKASQSSSPEMLRSEGSYSTGERHSSTDSNKASSGDVSPYDNNSPV
LSERSLMAAQEEVAHSPDKLYRAQEQYALGGHLQPKTKENSSASQAGKDVSEDHFDIWGT
WHSTLKSGCKDTGIAGSYGNIYESSLLRPGQCSLSQGNLSIYSPRWQGSSSELDHGRQVM
RRSQTTAAIPECQLQPAMSRVCSNPHIEAGGRCLDHSRSKSERHLTLSSVEDLTEHDSHA
GCSQSTAKPSYSKERPPPPYPGQPKRHDKSAGTRAAGGPVAKAPEQAVSKQERPAPHTQA
GHIYSTAAHSQNSKNVSEPDWHDWQRERWQIWELLSADNPDALPETLV
Download sequence
Identical sequences G1NPD8
ENSMGAP00000015585 ENSMGAP00000015585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]