SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015836 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000015836
Domain Number 1 Region: 941-1059
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000276
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015836   Gene: ENSMGAG00000014940   Transcript: ENSMGAT00000016799
Sequence length 1617
Comment pep:novel chromosome:UMD2:1:160479982:160523897:-1 gene:ENSMGAG00000014940 transcript:ENSMGAT00000016799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPEETNRRVKNVLITLYWLGRKAQSNPHYNGPYLNLKAFEKLLGQALTKALEESSHLNRS
GRDSGYGDIWYVDRGEPFPSSASHKRDDSFDSLDSLGSRSSTSFSSDITLKGGSEGCDSD
TDSELPFKMRDSHKDDRSYRRISVIEPKPATDFNRFLPTKNKQPTYMPAPLRKKRTEKNE
DNRRSWASPVYTESDGTFSRFLVQKSPVSSPAPGHHFVLRSELSGYFDEDEEEEIVIPNI
EKDDLYFRKLSSSASNTVVPFDKFLPKYWTPEELLWKKIRKSSFKPWYKEIQGFSQFLLL
QALQKYSDYLSSETKTKIDPTSGPRLIKCRKNISFIPGCDDEGDAENGYPYPDLENDDLF
VRKTGAFHMNHVVLQDPQYFRKFSEQESPLEGEIILQPREGQPVIPDLEKDDMIFRKILS
QKKEVPLSGAPDKYHPALFPDPWSLPEEIRSKFLCLLEKNSMPEERKRSGRVLSPSSRHK
RDDMLARKIESWKVGSNMQPVNFIPGPCSEEDWKKWEAIREASKVRHKKRQMVERLFQKL
SDEQGSKSLNDVSAEEQQSLRKIRYEELQKIKEQLQEQDLKWQEDLAKWKNRRKSFTSEL
QKKKEEREEIERRASEVSDRSSKPLKEMQQERNLNSFSSKLYLTISLSYNVLFAILFVTE
DKYSQSCYESHRKQDSLKSANVQIEYCSTKSDSFFFLMKIWVQIVLNVQYCQHLKFENYM
VKWPSLHSLLNKIRISEDMQQKAPATRSTVKDYLFEEETSYSTKDSKSQYAAQRSEENLP
KPESSAMREVPTVSKSLAEEQSSALLSTCYSVNAQTGSAQVSASLPRSYQKTDTSRLTSV
VTPRPFGVHSRGISSLPRSLTMDDAQKYNGEVEKAKATQTLTSSMFSLPDSTYSLSTSVL
RRRGEEEEEEKEGVKSVPTPSLTLPVKSQDRDAGNSILKPEYRSPPDSVSLASSAENASL
SEHDDSKSLELYSELRISMNQRPGYSHNFGFTTNWTSSGALVQTVEEDSPAALCQLQVDD
EIIAINGTKVSQMNSSQWEEAITRALETGNLVMDVRRYGKNGTSDNKWIDATSGERVSSV
STISTKREFSSSLQSSGTGTKLINGMQGDLGSNEQRASEPISLKNLKRRSQFFEQGGPEP
AMPDLPVPSISAPSRRVWDQEEERKRQEKWQKEQDRLLQEKYKREQEKLREEWLRAKQEA
EKENSKYLDEEQTVITSNMITVSARAPSASSWRASPEVSTPEEPEGDGGSELAAHLLAKE
EERRLQEEEAAALRAEREREHQELELERQRKEREQQYEQRQWAEMEEQRRQAEMEEQRQQ
AERQREMSVETSQYQRHYERYEVSKTTENQPGQHLIDRNKSKSISELNDFNANRNSTQSK
HSERSWNTNESQKGSQKEHNLSAAELERQQILQEMRKKTSLHTDSSWIRQRSSSVHKEPI
SLYSSSMRRGESLDNLDSSRTSSWRHHSRLNQSSSTSSLSSNQDHSRPVSTSNRAYMCTP
SSAKAPSVTTSVRAPPASQAAPRVQSPVSASQPGSQMRSRSVSGKKICSYCNNVLGKGAA
MIIESLGLCYHLHCFKCVACECDLGGSRSGAEVRIRNNKLFCNDCYLRFKTGQPTSM
Download sequence
Identical sequences G1NPZ3
ENSMGAP00000015836 ENSMGAP00000015836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]