SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000015898 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000015898
Domain Number - Region: 140-376
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.000235
Family Exocyst complex component 0.016
Further Details:      
 
Domain Number - Region: 609-757
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.068
Family DNA repair protein MutS, domain III 0.042
Further Details:      
 
Domain Number - Region: 48-140
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0719
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000015898   Gene: ENSMGAG00000014992   Transcript: ENSMGAT00000016862
Sequence length 771
Comment pep:novel chromosome:UMD2:1:176378872:176405483:1 gene:ENSMGAG00000014992 transcript:ENSMGAT00000016862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLPIEDLCSLTSQSLTVALTAAVPESTEDVLLKGFAMLGMENERIETAQQFFSWFAQLQT
QMDQDEGAKYRQMRDYLSGFQEQCDAILNDVNSALQHLESLQKQYLFVSTKTGTLHEACE
QLLKEQSELVDLAENIQQKLSYFNELENINTKLNSPTLSVNSEGFIPMLAKLDDCIAYIS
SHPNFKDYPVYLTKFKQCLLKAMHLIKTYTVNTLQNLTSQLMKRDPSAVPNSDNAFTLFY
VKFRAAAPKVRALIEQVEQRSEKMPEYQQVLNEIHQCYLDQRELLLGPSISSTVTELTSQ
NNRDHCALVRSGCAFMVHVCQDEHQLYNEFFTKPTPKLDELLEKLCLSLYDVLRPMIIHV
IHLETLSELCGILKNEMLEDHVQNNAEQLGAFAAGVKQMLEDVQERLVYRTHIYIQTDII
GYKPAPGDLAYPDKLEMMEQIAQSLKEEQKKLPSEASFSDVRLEDPESCNLVKSGSAESL
NPRQQSTISPADLHGMWYPTVRRTLVCLSKLYRCIDRAVFQGLSQEALSACVHSLLGAAD
SISKNKTQVDGQLFLIKHLLILREQIAPFHTDFTIKEISLDLKKTRDAAFKILNPKTVSR
FFRLNSNNALIQFLLEGTPEIREHYIDSKKDVDRHLKAACEQFIQQQTKQFIEQLEEFMT
KVAALKAMATQGGPKYSLSQQPWAQPAKINDMVSSTYKTIKTKLQSTLRSMSLYLSNKDT
EFILFKPVRNNIQQMFQKLHALLKEEFSNEDLQIIACPSMEQVNLLLSISK
Download sequence
Identical sequences G1NQ38
ENSMGAP00000015898 ENSMGAP00000015898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]