SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016017 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016017
Domain Number 1 Region: 568-684
Classification Level Classification E-value
Superfamily PDZ domain-like 9.07e-26
Family PDZ domain 0.0023
Further Details:      
 
Domain Number 2 Region: 438-551
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-24
Family PDZ domain 0.004
Further Details:      
 
Domain Number 3 Region: 219-311
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-22
Family PDZ domain 0.016
Further Details:      
 
Domain Number 4 Region: 328-427
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-20
Family PDZ domain 0.013
Further Details:      
 
Domain Number 5 Region: 40-93
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000117
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016017   Gene: ENSMGAG00000015103   Transcript: ENSMGAT00000016984
Sequence length 689
Comment pep:novel chromosome:UMD2:1:183700318:183723989:1 gene:ENSMGAG00000015103 transcript:ENSMGAT00000016984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTTGDDMALAEQNASLNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPLD
TPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSSILVHKLLDKLLVLCPFSSVCQE
VMQRCDLAAHLKNRCPGASHRRVALERRKASKLQAEAEGEAGPGGPEQPNSVSPDAEQSS
VPAEQSFTPALPAWADEPGIDNPPFEENTGADTNQQPPTLPEGEITTIEIHRSNPYIELG
ISIVGGNETPLINIVIQEVYRDGIIARDGRLLAGDQILQVNSFDISNVSHNHARAVLSQP
CTVLHLTVLRERRFGSRTHGHTDTTTTTSSSRDDSFQVTLHKRDSSEQLGIKLVRRTDEP
GVFILDLLEGGLAAQDGRLCSNDRVLAINGHDLKHGTPELAAQVIQASGERVNLIISRPM
KSQTVSIIRDTGTHNSNPHQHQSQQLFHSRPNSHKDLSQCVTCQEKHITVKKEPHESLGM
TVAGGRGSKSGELPIFVTSVQPHGCLARDGRIKRGDVLLNINGIDLTNLSHSEAVAMLKA
SAASSVVALKALEVQIVEEQPQANEEQLSTISENEYDASWSPSWVMWLGLPSCLHSCHDV
VLRRSNLGSWGFSIVGGYEENHTNQPFFIKTIVLGTPAYFDGRLKCGDMIVAVNGLSTVG
MSHSALVPMLKEQRNKVTLTVICWPGSLI
Download sequence
Identical sequences G1NQD3
ENSMGAP00000016017 ENSMGAP00000016017 XP_003203453.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]