SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016108 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016108
Domain Number 1 Region: 293-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.04e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000111
Further Details:      
 
Domain Number 2 Region: 2-185
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.21e-48
Family BAR domain 0.0045
Further Details:      
 
Domain Number 3 Region: 159-266
Classification Level Classification E-value
Superfamily PH domain-like 7.21e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 714-769
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000328
Family SH3-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016108   Gene: ENSMGAG00000015182   Transcript: ENSMGAT00000017080
Sequence length 770
Comment pep:novel chromosome:UMD2:1:190979191:191050157:-1 gene:ENSMGAG00000015182 transcript:ENSMGAT00000017080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQNANDVLIAPLEKFRKEQIGAAKDGKKKFDKESEKYYSILEKHLNLSAKKKESHLQDAD
TQIDREHQNFYEASLEYVFKIQEVQEKKKFEFVEPLLAFLQGLFTFYHEGYELAQEFAPY
KQQLQFNLQNTRNNFESTRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPLGFTW
IKHYCTYDKGTKTFTMSIAETKSGGKVNGLVTSSPEIFKLKSCIRRKTDSIDKRFCFDIE
VFERPGIITLQAFSESNRKLWLEAMDGKEPIYTLPAIISKKEEMFLNEAGFNFVRKCIHA
VETRGITILGLYRIGGVNSKVQKLMNTIFSPKSPPDMDIDMEIWDNKTITSGLKNYLRCL
SEPLMTFKLHKDFIVAVKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQ
NLMTVSNLGVIFGPTLMRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAPDPNIPLPQ
PQSRSSSRRTRAICLSTGPRKPKGRYTPCLADPDSDSYSSSPDSTPMGSIESLSSHSSEQ
NSTTKCVPSQPREKSGGIPWIASPPSSNGQKSSGLWTTSPESSSKEDATKTDMESDCQSI
ASVTGPENASPPIDLTKKSSYSLSGLKRSSGSSLRSIPSAEGNKSCSGSIQSLSSADTKD
TPKAPLNPDLPPKMCRRLRLDTASSNGYQRPGSVVAARAQLFESAGSLKQVSSGRQAKAM
YSCKAEHSHELSFPQGAIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL
Download sequence
Identical sequences G1NQK9
ENSMGAP00000016108 ENSMGAP00000016108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]