SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000016988 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000016988
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily Immunoglobulin 4.41e-35
Family V set domains (antibody variable domain-like) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000016988   Gene: ENSMGAG00000016045   Transcript: ENSMGAT00000017962
Sequence length 121
Comment pep:novel scaffold:UMD2:GL424909.1:21513:21875:1 gene:ENSMGAG00000016045 transcript:ENSMGAT00000017962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRPCVGGSDSGLYFPTGLMAAVTLDESRGDLQAPRGSLTLICKGSGFTFSSYGMQWERQA
PGKGLEFVTTISYDGSSPSYGAAVQGRATISRDNGQSTVKLQLNSLKAEDSATYYCTKCA
D
Download sequence
Identical sequences H9H210
ENSMGAP00000016988 ENSMGAP00000016988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]