SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017113 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017113
Domain Number 1 Region: 156-345
Classification Level Classification E-value
Superfamily E set domains 1.03e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000933
Further Details:      
 
Domain Number 2 Region: 47-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-18
Family Voltage-gated potassium channels 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017113   Gene: ENSMGAG00000016172   Transcript: ENSMGAT00000018087
Sequence length 378
Comment pep:novel scaffold:UMD2:GL428301.1:733:1869:1 gene:ENSMGAG00000016172 transcript:ENSMGAT00000018087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSATKVYYSQTTQTDSRPLIGTALRRRRVMTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFAFGVVWYLVAAVHGDLLEFEPPANHTPCVMQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLITQLVLTTIMEIFITGTFLAKIARPKKRAETIK
FSQNAVVAQHDGKTCLMIRVANMRKSLLIGCQVTGKLLQTHLTKEGESVRLNQLNVDFQV
DTSSDSPFLILPLTFYHVVDDASPFRDAALRTGEGDFELVVILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYVADFSLFDQVVKVAAPCCVRETVRFGDPEKVKLEETL
REAAEREGAPLSVRISNV
Download sequence
Identical sequences H9H217
ENSMGAP00000017113 ENSMGAP00000017113 XP_010725644.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]