SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017225 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017225
Domain Number 1 Region: 117-168
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000333
Family PDZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017225   Gene: ENSMGAG00000016833   Transcript: ENSMGAT00000019240
Sequence length 171
Comment pep:novel chromosome:UMD2:Z:9908461:9909090:1 gene:ENSMGAG00000016833 transcript:ENSMGAT00000019240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPITQDNAGVFLPLLWQWLQNSQREGAEGAEQKLCHAAVQKLSEYIQLNFSVDESKLQAG
SCGASDTEICTVYLAQEMRKTEVLGLSFGNIPALGDYGEKRRGGKKRKGHKGPVLDVGCI
WVTDLKKNSPAGKCGRVRLKDEILSLNGQLMVGVDVTGARSLQKSSNKNAP
Download sequence
Identical sequences G3UNU5
ENSMGAP00000017225 ENSMGAP00000017225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]