SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017807 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017807
Domain Number 1 Region: 339-629
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-69
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 71-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000132
Family LIM domain 0.00062
Further Details:      
 
Domain Number 3 Region: 128-160
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000542
Family LIM domain 0.00099
Further Details:      
 
Domain Number 4 Region: 189-275
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000373
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017807   Gene: ENSMGAG00000008461   Transcript: ENSMGAT00000019157
Sequence length 670
Comment pep:novel chromosome:UMD2:17:9471564:9489129:-1 gene:ENSMGAG00000008461 transcript:ENSMGAT00000019157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILPKGAGAAECRRGWFQPWEPEMSRRETWHSLGSLKQRQLDKFVAEPVYPLLKMGSYLSA
PAYFAPKDPFRCSECQDPLTNWYYEKDGKLYCHKDYWGKFGESCHGCSLLMTGPVMVAGE
YKYHPECFACMSCKVIIEDGDTYALVQHSTLYCGKCHNQIVLTPMIEKHSSESLREQLPY
TLTLISMPAATDGKRGFSVSVEGGCSSYATGVQVKEVNRMHISPDVRNAIHPADRILEIN
GAPIRTLQVEEVEDLIRKTSQTLQLLIEHDPVSQRLDRLRLDSRLPTHIKSPISPHSISP
LDIKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLLSRDISRSESLRSSSSCSQQIFRP
CDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNV
LKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNADPFPWQQKVSFAKGIASGMAYLHSMCII
HRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKKPTLEKPSAKKRTLRKSDRKKRYTVVG
NPYWMAPEMLNGQSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFV
PADCPPAFFPLAAICCRLEPESRPPFSKLEDSFEALSLYLGELAIPLPSELEELDHNVSV
QYGLNRDKLP
Download sequence
Identical sequences G5E7H1
ENSMGAP00000017807 ENSMGAP00000017807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]