SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000017855 from Meleagris gallopavo 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000017855
Domain Number 1 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-35
Family Third domain of FERM 0.0013
Further Details:      
 
Domain Number 2 Region: 106-213
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-28
Family Second domain of FERM 0.00036
Further Details:      
 
Domain Number 3 Region: 19-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.84e-18
Family First domain of FERM 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000017855   Gene: ENSMGAG00000016974   Transcript: ENSMGAT00000020528
Sequence length 498
Comment pep:novel chromosome:UMD2:5:45156302:45178839:-1 gene:ENSMGAG00000016974 transcript:ENSMGAT00000020528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELREIT
YFSLWYYNKQNQRRWVDLDKPLKKQLDKYALEPTVYFGVVFYVPTVSQLQQEITRRRYQY
YLQLKKDILEGNIPCTLEQAIHLAGLAVQADFGDYDQYESQEFLQRFALFPVGWLQEEKI
LEEATQKVALLHQKYRGLTPPDAEMLYMQEVERMEGYGEETYPAKDSQGSDIFIGACLDG
IFVKHKNSRPPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYVWRMCVAR
HKFYRLNKCSLQTQPITVNPVRRRSSSRMSMPKPQAYMMPPPPQLHYNGHYTEPYASSQD
NLFVSSQNGYYYHSQTSLDRAPHDYSGRIRNGSVYSAHSTNSLNNPQHYLQPSPMSSNPS
ITGSDVLRTDYVPSHRHSALIPPSYRPTPDYETVMRQLNRGMVHTDRQSHSMRNLNISNT
YAYSRPDALVYSQPEIRE
Download sequence
Identical sequences G3X8L3
ENSMGAP00000017855 ENSMGAP00000017855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]